CAZyme Information: PHYSODRAFT_559984-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_559984-t26_1-p1
• CAZy Family: PL3
• CAZyme Description: glucan 1,3-beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373		43347.79	6.2244

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159154:2554895-2556016(+)

Full Sequence      

MACVAPDSLQARLRRGDIPCRGVNLGGWLVAEHWMAWDSCLWHGVPDMIKNQGEFATMKF
LGHEEGDRRFDEHRRTWITEYDIAEMKRFGLNTVRVPVGFWIMGFDPTDFPNKQEWKVFA
PHALHYLDELVNHWCVKYDLAVLVDIHAAKGSQNGRDHSAAVDSGAKYWSQYPENVDNTV
YLANFLASRYRYCPSFLGIGLLNEPEVPTDPNVLRGYYERAYSEIRATGNDCVLTIAPLL
TEQSPPFMEDFMRYPKFFNVWHEWHPYFIWGYEGQRREQVLDAVRRYGNQISSWGGNWLL
IDEWSLGAQGCAFPSEDRHGLQQFASAQLEAFSKAHSGWIFWSWRHSDDGHNRPTGWSMR
QLLRDGVVRLYEV

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_559984-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	71	349	5.4e-43	0.9711191335740073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.23e-20	76	360	72	373	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.64e-08	77	344	24	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAM18484.1|GH5	2.22e-275	1	370	1	370
UIZ29723.1|GH5	9.51e-255	9	372	1	364
CCA15861.1|GH5	4.12e-153	8	370	11	374
CCA15900.1|GH5	3.28e-137	2	370	95	454
UJR33211.1|GH5	5.01e-118	5	370	26	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.42e-31	21	367	10	377	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	2.93e-31	21	367	15	382	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	5.19e-31	21	367	10	377	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	5.68e-31	21	367	16	383	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
2PF0_A	1.08e-30	21	367	16	383	Chain A, Hypothetical protein XOG1 [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12725|EXG_YARLI	1.81e-40	16	367	33	405	Glucan 1,3-beta-glucosidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=EXG1 PE=3 SV=2
sp|Q12700|EXG_SCHOC	1.40e-36	22	367	44	409	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
sp|B8N151|EXGA_ASPFN	9.85e-36	21	367	32	391	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
sp|Q7Z9L3|EXGA_ASPOR	9.85e-36	21	367	32	391	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
sp|Q5B5X8|EXGA_EMENI	1.87e-34	21	367	30	389	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_559984-t26_1-p1.