CAZyme Information: PHYSODRAFT_559651-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_559651-t26_1-p1
• CAZy Family: PL3
• CAZyme Description: putative endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241		25499.65	9.5956

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159154:981863-982588(-)

Full Sequence      

MKGFFAGVVAAATLAVASAGDYCGQWDWAKSTNYIVYNNLWNKNAAASGSQCTGVDKISG
STIAWHTSYTWTGGAATEVKSYSNAALVFSKKQIKNIKSIPTKMKYSYSHSSGTFVADVS
YDLFTSSTASGSNEYEIMIWLAAYGGAGPISSTGKAIATVTIGSNSFKLYKGPNGSTTVF
SFVATKTITNFSADLQKFLSYLTKNQGLPSSQYLITLEAGTEPFVGTNAKMTVSSFSAAV
N

Enzyme Prediction     

EC	3.2.1.4:15	3.2.1.151:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	91	240	1e-44	0.9871794871794872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	6.91e-52	34	241	3	207	Glycosyl hydrolase family 12.
235746	PRK06215	1.80e-14	23	207	41	203	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGZ16757.1|GH12|3.2.1.151	2.81e-169	1	241	1	241
ABB22029.1|GH12|3.2.1.151	2.81e-169	1	241	1	241
ABB22036.1|GH12	5.00e-142	1	241	1	239
ABB22037.1|GH12	1.68e-128	1	241	1	237
ABB92621.1|GH12	1.06e-106	1	180	1	180

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VLB_B	3.10e-86	21	240	6	221	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
3VL8_A	3.92e-86	21	240	13	228	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
4NPR_A	1.10e-76	16	240	21	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
5GM3_A	1.09e-55	23	240	4	218	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus],5GM3_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus]
1KS4_A	3.47e-55	23	241	4	223	The structure of Aspergillus niger endoglucanase-palladium complex [Aspergillus niger],1KS5_A Structure of Aspergillus niger endoglucanase [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G4ZHR2|XEG1_PHYSP	4.99e-170	1	241	1	241	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora sojae (strain P6497) OX=1094619 GN=XEG1 PE=1 SV=1
sp|W2PEP3|XEG1_PHYPN	1.11e-157	1	241	1	241	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XEG1 PE=1 SV=1
sp|W2PDG1|XLP1_PHYPN	2.53e-128	1	241	1	238	Inactive glycoside hydrolase XLP1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XLP1 PE=1 SV=1
sp|G4ZHR3|XLP1_PHYSP	1.89e-107	1	180	1	180	Inactive glycoside hydrolase XLP1 OS=Phytophthora sojae (strain P6497) OX=1094619 GN=XLP1 PE=1 SV=1
sp|Q5BG78|XGEA_EMENI	3.45e-86	6	241	9	239	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000195	0.999780	CS pos: 19-20. Pr: 0.9695

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_559651-t26_1-p1.