CAZyme Information: PHYSODRAFT_559068-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_559068-t26_1-p1
• CAZy Family: PL3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
473	JH159154|CGC13	54739.17	5.9434

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159154:284116-285537(+)

Full Sequence      

MKLLFQSLYVSPRELALQQKEEERRRNEATAQEPKQTMRGKKKPQDADGLDARGQGETFQ
AETLAENHALRLKLLAEREEEAERERQMSLPPGFFLQTRGQGHEAISSKSAYCINVVTPS
DSPGVLLDFELYLNALPSARPVYAYRGNGEQESDSYSDCDGQAVKRLDMPPSVIDIYLER
HPVDRKYYPDFHAPKEKTIWMMQNVEFFDRHELANPTVGVMMVKNRIGLKKVLEYRHRHQ
LSYSVFYTKHTSRDLYQPAVQRDWTSFLHLAGWSPFKNTRVILQAWALHPEWPQLIIRVI
KADLCAWIEEQFGTKETWRLQNVDYACGSVPAEEKDRLQNEIGLHLCPSETEGFGHYINE
ARSVGALILTTNVPPMNELVDEKSGVLVGEPHPWWWQTKGDLFMPLAQVDVADIERGVEQ
ILLLSIEERQRMGRRSRAKFLEDRAYFLNAMTALEESLCQDEIRIEKLQPYLY

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_559068-t26_1-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340831	GT4_PimA-like	3.51e-13	267	442	195	350	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
223515	RfaB	6.58e-10	267	443	202	360	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340816	Glycosyltransferase_GTB-type	2.81e-08	211	388	61	235	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
395425	Glycos_transf_1	5.49e-07	277	437	15	156	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
340837	GT4_CapM-like	2.04e-06	348	443	270	347	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29740.1|GT4	3.54e-276	1	473	1	468
CCA20002.1|GT4	1.46e-183	93	473	108	470
QEO25224.1|GT4	1.07e-32	252	461	133	325
QSQ33804.1|GT4	1.07e-32	252	461	133	325
QNH11168.1|GT4	1.07e-32	252	461	133	325

PDB Hits     

PHYSODRAFT_559068-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PHYSODRAFT_559068-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000004

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_559068-t26_1-p1.