CAZyme Information: PHYSODRAFT_556171-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_556171-t26_1-p1
• CAZy Family: PL1|PL1
• CAZyme Description: cellulase-1, endo-1,4-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542		58758.31	4.4434

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159152:2325638-2327336(-)

Full Sequence      

MSTSGRPSGVGRGSFSAGRSSEVERIIAAAEVDTTFAGKKARYRGRRSTWPGALALLLLA
VVSVAGLTYYGIQTHNDVNETVASSEASDEAKYSDGTQIDDGSPTDTTSDLATTNPKMYT
DKGCQQPNYISKNGRIYAQLADGTSTQIDIKGINWKGMEDSKGVPKGLWDNTVDGDSLYR
YAYFLHYNKFNVVRFPLSIDAVMRNTDIDTNLINTNSNRALATASRYNTLLGLMVQGLGQ
FNIGVVLDFHVLSTSDDDSSGLWYGSSIKLADIKTAITNLAEAMCDSTHFNIIGIDLKDG
LSTDATWGDGSDTDWSVAATELGNHLLTKCPKWLAFVQGVQGESHKDTYGSRSIKNTFLP
GSDLSGVSDAPITLDTDNKVVYSPKYYSSSYIPRLYYFEDGTTSGDLLEDYVEYGDADLL
ANVKLSMNYSFGAAFDTGMAVVLSSFGGLVGDLDATDKQTSTRIVKDVIAQMAGTTEPYL
AGGFWWTLNPDTTWPYPAPDDTNATAQGLVDDTWRVANMDVLQVLASMNKTMDHVKFIPC
ST

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_556171-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	147	492	1.8e-129	0.9912790697674418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.04e-06	142	356	39	249	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ25210.1|GH5_20	0.0	1	542	1	542
CCA23923.1|GH5_20	2.16e-182	2	540	4	535
CCD28218.1|GH5_20	4.21e-165	265	541	3	279
ABC87090.1|GH5_20	1.59e-104	19	540	112	627
ABK59037.1|GH5_20	1.59e-104	19	540	112	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VVG_A	4.47e-23	129	514	8	361	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	4.47e-23	129	514	8	361	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3QHN_A	5.67e-23	129	514	41	394	Crystal analysis of the complex structure, E201A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHN_B Crystal analysis of the complex structure, E201A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHN_C Crystal analysis of the complex structure, E201A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
3QHM_A	7.61e-23	129	514	41	394	Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_B Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_C Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
2ZUM_A	1.02e-22	129	514	41	394	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54583|GUN1_ACIC1	2.24e-20	139	518	53	381	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P23548|GUN_PAEPO	1.11e-19	139	522	45	378	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P19487|GUNA_XANCP	4.93e-16	128	528	25	368	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999790	0.000240

TMHMM  Annotations     

Start	End
50	72