CAZyme Information: PHYSODRAFT_553859-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_553859-t26_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
825	JH159151|CGC38	92576.79	5.9238

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:2480758-2483477(+)

Full Sequence      

MFSAEADYEALLPVDAPRAPPARARRRVQRMDVALLAVVLFVACFVGVRPPALRVSNPLL
LPKAQAEAQFMTYEDIDAAKRQAGYSVSYSARGFEIDGRRTLLLGGSIHYPRSSEGEWET
LLRAAKRDGLNHIEMYVFWNLHEQERGVFNFAGNANATRFYELAAEVGLFLHVRFGPYVC
AEWSNGGLPLWLNWIPGMKVRSSNAPWQWEMERFVTYMVELSRPFLAKNGGPIIMAQIEN
EFAMHDPEYVEWCGDLVKRLDTSIPWVMCYANAAENTILSCNGNDCVDFAVKHVKERPSD
PLVWTEDEGWFQTWAKDKKNPLPNDQRTAEDMAYAVARWFAVGGAAHNYYMYHGGNNFGR
AASAGVTTKYADGVNLHSDGLSNEPKRSHLRKLHEALIDCNDILMRNDRQLLHPHELAPT
HGETAEASSLQQRAFIYGAEDGPNQVAFLENQADKKVTVVFRDNKYELAPTSMMIIKDGA
LLFNTADVRKSFPGTVHRAYTPIVQAATLQWETWSELNVSSLTPRRRVVAERPVEQLRLT
ADRSDYLTYETTFTVDPADTPIDIDSDASTVKVTSCEASSIIAFVDGWLIGERNLAYPGG
NCSKEFRFSLPTNIDVTRQHSLKLVSVSLGIYSLGSNHTKGLTGKVRVGRKNLAKGHQWE
MYPTLVGEQLEIYRPEWLSSVPWTPVPRVVASGRQLMSWYWTSFSYPAFELPAEADPVSE
PFSILLDCIGLTRGRAYINGHDLGRYWLVNDEGEFVQRYYHVPRDWLVKDQANVLVVFDE
LGGSVADVRLVSSSMVPDAVGDAAAAKFLEKSSPTAGEVVYVARE

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_553859-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	94	395	1.3e-87	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
166698	PLN03059	2.93e-128	86	795	29	728	beta-galactosidase; Provisional
396048	Glyco_hydro_35	7.31e-96	94	394	2	315	Glycosyl hydrolases family 35.
224786	GanA	1.23e-18	87	359	1	292	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
396834	Glyco_hydro_42	0.002	109	253	6	150	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26848.1|GH35	0.0	1	796	1	796
CCA17560.1|GH35	2.66e-241	30	795	40	794
ACD54699.1|GH35	4.23e-150	71	784	22	721
UJR36785.1|GH35	5.95e-150	71	791	22	732
ACD54708.1|GH35	7.88e-147	71	784	22	721

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5F_A	1.36e-110	82	811	3	717	Chain A, Beta-galactosidase [Solanum lycopersicum],3W5F_B Chain B, Beta-galactosidase [Solanum lycopersicum],3W5G_A Chain A, Beta-galactosidase [Solanum lycopersicum],3W5G_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK5_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK5_B Chain B, Beta-galactosidase [Solanum lycopersicum]
6IK6_A	1.02e-109	82	811	3	717	Chain A, Beta-galactosidase [Solanum lycopersicum],6IK6_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK7_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK7_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK8_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK8_B Chain B, Beta-galactosidase [Solanum lycopersicum]
4MAD_A	1.40e-43	94	403	24	345	Chain A, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
7KDV_A	1.68e-36	82	370	13	308	Chain A, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]
6EON_A	7.57e-36	84	364	17	311	Galactanase BT0290 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9MAJ7|BGAL5_ARATH	2.47e-111	86	795	30	731	Beta-galactosidase 5 OS=Arabidopsis thaliana OX=3702 GN=BGAL5 PE=2 SV=1
sp|Q9FN08|BGA10_ARATH	8.51e-111	86	790	31	733	Beta-galactosidase 10 OS=Arabidopsis thaliana OX=3702 GN=BGAL10 PE=2 SV=1
sp|Q9SCV4|BGAL8_ARATH	4.44e-110	86	792	31	734	Beta-galactosidase 8 OS=Arabidopsis thaliana OX=3702 GN=BGAL8 PE=2 SV=2
sp|Q10RB4|BGAL5_ORYSJ	1.84e-109	86	795	26	726	Beta-galactosidase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0165400 PE=2 SV=1
sp|Q9SCW1|BGAL1_ARATH	8.00e-109	86	791	33	730	Beta-galactosidase 1 OS=Arabidopsis thaliana OX=3702 GN=BGAL1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999997	0.000036

TMHMM  Annotations     

Start	End
33	52