CAZyme Information: PHYSODRAFT_552631-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_552631-t26_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1437		158088.51	8.7627

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:8662054-8667024(+)

Full Sequence      

MRTVSVLAWTATLASSLVAGRNSSTEYPTKSGIRTWVDPETPADRQIYLSSRGRQWELVM
SDEFNVANRSFRPGDDHMWTSLEKPDGVNGALEVYAHNMTSTKCDNDGTCYFYIETDTDN
VTISVYNMYKHPPGYQNASFYYRAAMVQSWNKFCFQGGMLEVRAQLPGAVSKASNNPDLA
LGKSGQVTDTTYYPTWPGIWMMGNLGRAIFSASTNRMWPFSYNKCEPDIFDPVNQRISAC
DDDPGYGLNPNQGRGAPEIDLLEGGGLAISSSLQIAPGMPSDFRLFPADAKGADLTNPYC
VYTYDCKTQGANLIDVPTSYYEKERGHKSWYQGLRYAANNYCSKKSSKVQSFTTINSSVA
RGITQNSCTTSTCPASLDVNGDLSIIDGTGKNHWGINSNGTCFPIMNSYMGSYLCDPDNS
DGRCASPRNSSTPRSYAMDPFNYQMDAISSNWPVHLGAYTDYLTYQLEWVTGENGYVRWM
LDSSPLFEVTTDAFSNVPQNANNSNPEKVMLEEPMSLIFNVALSSSWGTRPPNAGGECRG
DGSNEKVNKICDEFPMFMKIDYIRLYQDLGDDLEADNYMQVGCDPASHPTKEWILGHIDE
YQDNDNLVTEVSAAKRNEAAIKASMMMTKSNPEARVPDTNSYVSHVRSFHGMLGIKPFVQ
ESVQALPAAQLRLLAETLRIDLRGCEDRGDIERVLTGLVCLDQDTSLGVFLAWLRSADLQ
QHKNGILASKKPRFNNTFLPAISSPPTDNQKSRSEAVKDHHLDDEIKQQLAELEVLETSF
KKAERLVHTGAPSFEKLKQFLMELTILRAKEQSARAFLVRQANVLKEQHDEMRAEMLHSR
AQLDFFVEGFTNLRKRHDALLEDATRMKAESETTQDIFVSMSAHDCYFEQLMKNTLWQQM
RDNDEMKRRLQQAHDDLEAAAQKRKELEAQISQLKQQRGDAQKDAYCYKRQLRVCKARMR
KLQQAGGGVNGSFFRDQAVALRQTVATLVRLLRDAVVRDTKSPKQTLSKEALRILHQILT
PVVSVSENESISSWSLRGADNQQEPESEEVDATQPRVIQRRTDHDIDEVIRGVLLVEGAK
PTDGAESYAEPLKKHVFDLMAAQGKRGFVMYNWPFTSRDVNLLTAMGLPVDSVINLEIGG
GVQPPPTAAAIPAVTSAAKAVPSTSASPVVKPKTPAVTSKPATTSSSTRGKAPTPSPAAR
GKASPTKPAAASKSPAKPVGRTTAPTAAAKTRAASPTRPAAVSSKKPTSSIPSSPSKPKS
PSVPSKPIKPGSSSSQLKPKTSEVTKAVKKVLTAASMLQGLGGILQPVGPAAFPAERVNA
ILQVLEQQKRRKLAPVVQWDEATRRTNEMLAMWAEEVHMLVHLEQESRKPQKPQTPAPAS
PAKSTTSTSPKRAVSPSKTGSKSSAVKAKAPVSPTRSSPTKAKTTSTTATKARPAKK

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	62	282	1e-61	0.5950920245398773

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	1.03e-69	19	609	79	483	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	4.13e-54	58	567	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	1.57e-09	447	566	145	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
224117	Smc	2.05e-08	760	963	740	925	Chromosome segregation ATPase [Cell cycle control, cell division, chromosome partitioning].
274008	SMC_prok_B	3.58e-07	754	999	219	456	chromosome segregation protein SMC, common bacterial type. SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle. [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27810.1|GH16	0.0	1	611	37	649
UIZ28149.1|GH16	0.0	27	612	29	611
UIZ28151.1|GH16	0.0	23	612	26	614
UIZ28152.1|GH16	3.09e-296	17	612	5	599
UIZ28150.1|GH16	9.97e-267	60	612	1	549

PDB Hits     

PHYSODRAFT_552631-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32486|KRE6_YEAST	1.41e-38	26	609	295	694	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P33336|SKN1_YEAST	6.16e-37	26	607	347	744	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P87024|SKN1_CANAX	2.70e-36	27	603	325	716	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P87023|KRE6_CANAX	2.30e-32	27	603	321	719	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|O13941|YEPB_SCHPO	3.08e-28	37	609	219	610	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.036922	0.963036	CS pos: 20-21. Pr: 0.7723

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_552631-t26_1-p1.