CAZyme Information: PHYSODRAFT_552348-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_552348-t26_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
598		66789.49	6.5340

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:6913548-6915344(-)

Full Sequence      

MYLALGSAFTAVEYQDMQVQLGTEHSIVAINGAPARDGHQVNGISFVISLNNGQQWVLYF
FYNAGGNTTLVFKDNKLTTTSKFTGVVQAAFVSTSGVQPDVPQDDHKILQLYHASAGVYP
RGVTVQPLNSESFAFRWQLTTAAGVNPGARFLHFALTHLQGMLDPSTAEAKHELVLHSHT
HGPLFAYALVSPPNSSPTWLCHVPQAESQGVEACTAFYPPRAGSLTREEVDRLNLCRVVA
DEIHGEWSLPHEGSYYFKGKLLQKFGTMCLVARQLADTTNPEMRDVAQHGISKFQQLLAQ
FVNNQSAFPLVYDTVYKGIITSEALTKNDMNVDFGNGVYNDHHYHYGYIVTAAAMALYLD
PNWCHSVDAVRVRTLVDTLIRDVANPSPIGTDPYFPRFRYYNWWLGHSYSHGVTPMADGK
DEESTSEEVNFLYGIALYGQVTENAQQQSLAKLMLKAYIRAVNTYFLLRNDGPAIHPAGF
AKNKVTGVFFDNKCDYTTWFSPNKECIHGIQMIPVSPILEVSRPTRFVREEWEEVLSKLP
FVHDWRANQSGWTSLLFANYSVLDRAKAFEVLSTCPMDDGLSRAWALYYAATRPPACC

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_552348-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	2	589	1e-136	0.8295819935691319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	2.54e-135	253	587	29	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	6.03e-108	3	591	197	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	9.46e-15	6	188	126	299	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26643.1|GH81	0.0	1	597	158	755
CCA20580.1|GH81	1.35e-159	2	593	302	882
CCA20581.1|GH81	1.37e-159	2	593	302	882
CCA20579.1|GH81	1.47e-158	2	590	316	893
CCA20578.1|GH81	3.00e-147	2	576	316	879

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	9.62e-77	6	594	160	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.48e-76	6	594	185	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.84e-73	6	594	160	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.74e-21	220	589	310	652	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	7.83e-15	250	581	355	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	9.36e-82	43	591	180	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.77e-73	3	591	187	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|D4AZ24|ENG1_ARTBC	3.64e-72	3	591	342	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	7.62e-63	44	590	584	1109	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	2.10e-62	42	591	613	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.988394	0.011638

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_552348-t26_1-p1.