CAZyme Information: PHYSODRAFT_551011-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_551011-t26_1-p1
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530		58737.78	4.4807

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159164:861834-863426(-)

Full Sequence      

MKVQAAIAGLLSLTGLASAADPSWHDLAISAPHYRRYLTRTASNEPFFWQADTAWELIHR
LNKTSIDFYLKTRAEQGYNVVQTVLVSELDGTTRANFYGDLPFNNSDPTKPNDAYFELVD
WTVDLAASYGILVALVPTWGMYVNGGWHSTTPIFNESNAYEWGKFIGERYPGLPKILGGD
SNVMWSWNMSAVQAAYAEDPDQDLPSLMAPVEDTSSVWASMRRGLKESESSQGYESVVLY
HPAGGWIVKPEVTPLAYGHNMLQDEEDRVSIDAVQSGHAIPDPTSKFTPAVGWDSRNNYE
NIAEMRDKFTGPVLDLENHYEGAHYSFSLTQPIWNASEVRTGLYHGVYGGAAGFTYGANS
VWQMYEPRADLVSDDVYYDPQINQNATGSWRRDIYFEGATQIQHVTKPLQNLTTAILESL
EPARELLSSPSGHTDKSVNTYEGTRYISILASKSRDRYFVYTGHGDSFSLQLDNGSGART
GSASWFSPRDGQYSANSTVSVPESGNGTRVDFTPPSGGGVDDDWLLVLEF

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_551011-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	35	500	3e-81	0.9393203883495146

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	5.02e-123	35	412	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	8.74e-15	443	529	12	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	1.21e-171	1	529	1	534
KAF3763706.1|GH140	1.26e-160	16	528	19	535
KNX49908.1|GH140	9.51e-76	36	529	23	518
KAE8156220.1|GH140	1.59e-74	20	529	17	508
KAB8225539.1|GH140	2.38e-73	32	529	31	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	3.33e-21	24	528	13	444	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	2.61e-19	24	528	13	444	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PHYSODRAFT_551011-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001199	0.998782	CS pos: 19-20. Pr: 0.9728

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_551011-t26_1-p1.