CAZyme Information: PHYSODRAFT_548975-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_548975-t26_1-p1
• CAZy Family: PL1
• CAZyme Description: putative endo-1,3-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1026		112437.98	4.8055

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159158:3484458-3488480(+)

Full Sequence      

MLADVPFPTGAWWTNLVLAEGQSAVATMPYVHRILDEKLHVSFPFRVVAPRSIIEGFLAQ
MVVSSQAAQTSSLPLAHHVVNFDAFSTTLRFSRGQTEEFRVYLVRGSPYITMEYSHSRPV
VEAKDGLQIKRFKKLKGLTLMNGEDAPFATFAAELNNGQTWYLYASDKQLKLRLDSNGQV
TSDEPFTGVLRVALCLDAKVMPFLLESASVYAVGGDMAHSVDPEDADKALLEFQWKTKSF
STFHGKAEGVSDEENGKLLMLALPHHMDVMQVQKSGKTVDKGKNKVLSGLRYTSIRGLME
GVFGAVWHMKETLPSVEWNYADDGLFSDDFSGSLKDGSTDDEQRRLDMREKAKQAILKQL
PLDVDAYPPPLSPDSYNFGKQVSRDARLLLIADKFDQEEVKQKLLLKVEMEITEWLEATN
ANHFVYDQTFGGIITNDGWHDKEADYGNGYYNDHHFHYGYFIYALAAIRKFDPAFIEKHA
QACALLMGDIGTPLLDSNTTFFNDLPVRLLFPTARHKDWFVGHSYASGLFPMEDGKSQES
SSEDLNAYYALALFSSLDEKATEGQGDSSYHQYARLLLATELRSVKKYWHMAENSKIYEP
AFSKNAMVGVVGEMSAVYNTWFGDRAVYIHGINMLPFTPFTPHLLDEEYYVAREYALLSQ
DLPDLDQYDIWRSIVVMDHAILNAADAWDELNNTVKAFDTWSSRANAMYWIATRPSWFAQ
KNRAVLSNPDLDADDKCFGFPACASAGENGTALMCCGTLPGCCPSHLGCCPQEDPALLPS
NACFGEHECAVLGLGCCNTIDGCCEPDPITGAVLGCCKNQHPVVSNTTHKPAHTAKDDAV
CYGEPLCAAAKLDCCGAPGGCCAGSGVTLDCCSSETPVSVLSSSSHSSDANTCQGQPKCG
AAGLDCCGWDGGCCKPDPVTGAKLDCCQDEAADAPSTETIPIRSGNGHHEDRDSDDSDAG
ENAGDTVTRIFIGLGGAVLLIAIVYAVGLCYRRRGYASIDGDMRSLYCAGLMVGVIAFFV
FLIVTA

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_548975-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	4	710	2.4e-156	0.9726688102893891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	3.04e-77	6	689	89	727	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	1.95e-76	350	702	4	348	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	5.23e-52	4	321	12	317	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29064.1|GH81	0.0	1	1026	69	1080
CCA18874.1|GH81	6.44e-234	5	1021	28	921
CAN97272.1|GH81	8.41e-107	1	715	88	718
AGP40408.1|GH81	2.97e-105	6	715	79	702
AUX36386.1|GH81	1.48e-104	6	715	90	713

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.07e-51	8	727	42	731	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.38e-51	8	727	67	756	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	6.45e-50	8	727	42	731	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5V1W_A	1.84e-32	6	711	48	689	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]
5T4A_A	2.08e-32	6	711	68	709	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125],5T4G_A Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	5.01e-40	151	712	183	697	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	8.52e-39	56	688	297	873	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	4.25e-36	6	689	110	750	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.04e-35	59	690	529	1122	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.33e-35	4	710	431	1104	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

Start	End
970	992
1005	1024