CAZyme Information: PHYSODRAFT_546965-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_546965-t26_1-p1
• CAZy Family: GT90
• CAZyme Description: pectine lyase-8

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
424		45135.76	9.6751

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159156:1392383-1393657(-)

Full Sequence      

MQIFRLVIVAVAAFAMQGAHAGSSTTALQNSDVAQTSTKQGVTTKSSISTGSAPGLAAGT
TGGGNIAPVYPASLNDLRNYLQDSQPRVIVLTKTFDFRGSEGTKTETGCRPKSHRDCLAK
NNGYKGQDVILQSGGFANTGGCVQGTSVKITYDIAATKNPLIVSDNKTLRGLGTNGVIKG
KGLWLRGNNIIIQNIHITQLNAHLIWGGDAIYIQGLNGGKTPMERVWIDHVKISNLGRQM
IATGSASVKSMTISNSEFDGRTQYSATCDGNHYWTFLFLGTQTQVTLVNNYVHNTSGRSP
KVAENSIVHAVNNYWVNNTGFSYDVLQNGNVLLEGTYFENTAIPNKHDAETVGAIIAPSS
TMQSACKNALGRNCVENVVSNCGTLTGYRESAALANSKKVASYYKPTSAKKFGTTSQNFG
VGQI

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	150	340	7.8e-77	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.09e-24	148	341	2	189	Amb_all domain.
366158	Pec_lyase_C	1.54e-08	158	338	27	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.
226384	PelB	4.49e-08	123	340	51	275	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74067.1|PL1_4	1.73e-229	1	424	1	432
ACR19249.1|PL1_4	9.96e-229	1	424	1	432
ACR19252.1|PL1_4	1.34e-226	1	424	1	432
ACR19255.1|PL1_4	1.03e-220	1	424	1	398
ACR19247.1|PL1_4|4.2.2.10	1.69e-219	1	424	1	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	1.05e-69	51	423	5	359	Pectin Lyase B [Aspergillus niger]
1IDK_A	8.97e-68	51	386	5	322	Pectin Lyase A [Aspergillus niger]
1IDJ_A	8.34e-65	51	386	5	322	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	2.13e-85	55	405	29	372	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	4.17e-81	55	424	29	382	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	4.17e-81	55	424	29	382	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	1.11e-80	50	424	25	383	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	1.11e-80	50	424	25	383	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999758	CS pos: 21-22. Pr: 0.9793

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_546965-t26_1-p1.