CAZyme Information: PHYSODRAFT_538740-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_538740-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	JH159151|CGC9	40149.44	7.6913

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:1861882-1862994(-)

Full Sequence      

MIESVISRKQGVVSSGAVTSTLESGVLTLAIQSWLNTHGKDGGDSDRVSKFTTYADSIVT
STSPSFKDPASAAKMPLDRFTIGQALLNIKSTEGSLTAVETDTLTLLNTSLSLQNRNQYN
GFWYYVYPYWSYLDGAVSFLPYMAAAPGWTYDDMLLQIKLLYSNTYNKSTGLVVHGYDAQ
KKAVWANEATGASPYVWGRSLGWYLAGLVNAWEKIGNCNGGANASCKALAAEIQRQTSVL
CNSIVRYADKKTGVWWQLPTLGGQKGNFLESSSTMLYTFSILKGLRLGLLEDAHGLKAAA
MKAYDYTVKSGAFLLDYGNGTLGWNGTVIVCSLNSTATYDYYVGRPTLQNHALGEGAFVL
ASLEVEQLAK

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_538740-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	47	367	1.8e-45	0.891566265060241

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226678	YesR	1.28e-33	115	369	115	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
400034	Glyco_hydro_88	2.82e-31	114	368	108	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26402.1|GH105	4.97e-183	1	369	31	402
UQC88631.1|GH105	3.58e-118	1	367	1	359
QUC20491.1|GH105	1.46e-108	1	368	34	395
QLI72757.1|GH105	3.08e-108	1	369	15	378
QPG98202.1|GH105	5.06e-105	1	367	31	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	3.71e-37	115	368	123	367	Structure of Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.59e-36	115	368	113	357	Chain A, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	2.97e-34	77	368	74	361	Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O34559|URHG2_BACSU	1.91e-36	115	368	123	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
sp|P0A3U6|PIC1_AGRFC	2.31e-20	152	370	20	233	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
sp|P0A3U7|PIC1_RHIRD	2.31e-20	152	370	20	233	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000021

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_538740-t26_1-p1.