CAZyme Information: PHYSODRAFT_531884-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_531884-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
785	JH159164|CGC1	85846.32	5.1458

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159164:989289-991973(+)

Full Sequence      

MIGTASARAQPTRDGRDGKVSKQWKTARSDQPSPLGSSGPSCVYQNLRCWVLCRLPPSLI
NSPPKDQARGKVTEDAIVSTDYCASRCSDRHVWPARRRGRVRSGELLLRHSRCWHNVGRG
GQLCWRPPQNLSIGQVSSSSDRVDIAGSFGGSNWTWTFVAGGDVANVYLAYESPPEEAFF
GLGEQTGIGNLRGWRVPIWTREGGAGRGEEPITSVLNANPAAAGTFAGGSLLTTYTAIAS
LTSSLGRWIVLDGANYALFDLASNATSSFEDTAESYLAGDIVEGDHSNSSSTTVEIQYEG
NSISGWLGRATDGNPLLEATGALTKITGRQPELPAWVNDGAILGIQGGQDFVEEVIQDAL
NAGLPLASVWLQDWSGTRLQAGSYGIYVHRLWWNWEPDTTLYPSWAEWVPYLRDEYNVRT
LSYVNTFLANVSTKSTGYNTSFYDIAKGEGRFVANSSTESDGDSVWTITSGVGIDAGILD
LSNQSTINWFKDLVKQQYYSVPISGMMQDFGEYLAVDDSVTLSHGTVSPRQFHNAYPTVW
ATLLRENIDESREDGLRAAVSSALHVGASGFAHTHSDVGGYTNILSSIGNFTRSAALLGR
WGELSALSDAVFRTHEGNIPQVNAQAYTNASTLAYHAYNTRLFRSLKKYRLALQTEYQTR
GWPVLRHPIVYSPSHSVARTIIDESFWVGEALYVAPVYDVRASSLEVYLPPLEIDSEGGK
LNATSVVYKHLWSGEEFQAGQTVTVDSPWGQPGVFVRWPVTKDEEAQLQGLWEFVEAEKS
TVLTA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	551	757	3.8e-26	0.4262295081967213
GH31	313	551	4.6e-20	0.48009367681498827

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236691	PRK10426	2.86e-127	167	757	72	618	alpha-glucosidase; Provisional
269880	GH31_glucosidase_YihQ	3.88e-121	328	640	1	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
224418	YicI	8.46e-43	165	757	141	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	6.13e-29	313	757	5	437	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	9.60e-18	331	711	9	361	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK39259.1|GH31	3.87e-145	164	785	154	768
BCS28035.1|GH31	1.61e-144	167	783	155	756
UJO15759.1|GH31	2.14e-144	167	784	162	766
SMR43741.1|GH31	2.84e-144	128	784	128	764
SMR41549.1|GH31	4.00e-144	128	784	128	764

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AEE_A	5.53e-56	167	757	117	663	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
5AED_A	1.03e-55	167	757	117	663	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
5OHS_A	1.98e-52	164	757	97	648	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5OHY_A	2.69e-52	164	757	97	648	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
6PNR_A	5.27e-52	176	757	111	649	Chain A, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32138|SQASE_ECOLI	4.72e-55	167	757	117	663	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000035	0.000008

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_531884-t26_1-p1.