CAZyme Information: PHYSODRAFT_531145-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_531145-t26_1-p1
• CAZy Family: GT71
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658		70457.65	4.3288

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159164:195954-198041(+)

Full Sequence      

MKVQATIAFVASVLAAVVSGNAAAPWEQYIQSPVSRYIEPVGIYGSSGNVNVSDLTATLS
GNGSTVTYDFGQQVTGFITLHFGSGTAKPDSSYTFGREFARGSYRYLTLSTSSSDAIEVT
GVSTHFTAAPATDDDKLREYSGYFYSDDDLLNRIWYAGAYTVQLCTIASNESRANPPTIT
EYGWFNNATIQNVTTGAEVYVDGAKRDRTPWPGDFGVSTLSKVVSLNGDNLLSVRHAINS
LYAIQNTTNGQFAYAGTPIAPRVQLAGINSDTYHIWTLIALADYATLTADTEFVENLWDQ
ALYGFEFILGNVDTSDMLLNVTGVYDWGRVGQGGKNIAANSLLYHALYSYAELAPQLGLE
VPSYNGTAFGELASAVKTAVNSNLWDDSAGLFRDNTTAAGGELHPQDGNSLAVRYNLTQS
SEQAATVSENLATRWNEYGAVSPEGLGSISPFITSVEVEAHLRATPGNASLALEIIRRQW
GYMLKAFSNSTTIEAYYETGELMYPFYGLELGGYISHAHAWSTGPTASLTLHVGGLSPVT
DAGKTWEFVPHAAGADVGELHTGYTMATGDFSVEWTTKNEDSFFFANFETPHNTTGSISV
PTFGKSLDSIEISINGNTVWANGAASWSGFGAASGSADFVTVPEVPHGGWFSIVAKDA

Enzyme Prediction     

EC	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	91	599	2.6e-67	0.8650793650793651

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.33e-09	142	521	4	328	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225942	GDB1	0.001	276	451	343	521	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
224541	TreA	0.006	325	497	334	518	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFA41507.1|GH78|3.2.1.40	7.27e-130	1	619	1	653
AFA41506.1|GH78|3.2.1.40	7.27e-130	1	619	1	653
CAE7020670.1|GH78	1.94e-128	23	601	19	627
QRD03625.1|GH78	1.54e-126	19	601	11	623
UJO19954.1|GH78	6.18e-124	21	619	16	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.58e-10	66	554	194	657	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PHYSODRAFT_531145-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000250	0.999730	CS pos: 22-23. Pr: 0.8582

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_531145-t26_1-p1.