CAZyme Information: PHYSODRAFT_526895-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_526895-t26_1-p1
• CAZy Family: GT7
• CAZyme Description: glycoside hydrolase family 17-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	JH159161|CGC7	40143.37	4.0278

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159161:1838888-1840096(+)

Full Sequence      

MVFSSSTRVAVVMAALAVGADAGALSTGVCYAPWHHSSVDSSVVGQDMAEIVQYFSSIRT
FQAQFSGVNVIEAAAAAGLKVAVGVQLSDSSAIDSEIQAVCDGYSSNPDAVEAVYVGNEN
LQNGNFGSFSAVTLVGYINKVRACVGSTPVGSVQRINEWLSADGAATLAGASDVIGVNIY
PFFTESDQTAVEKLEAQWGQMTAKYDSSKLHLTETGWPSSGENYGSNAPSTENMQQYLDD
YVTWSKGVGQSYWFMMYDTTTSYTGAEYEKHFGVFTSDGTVKVTIPGGDATAVQQTNSTS
SSVAADIITDAPVTDAPVITETPATTIPVVTEAATTAPVVVTNAPTYTNAPSTDGSAQAE
VAPVATTATPTVTPAPAPVVKGCKAASK

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_526895-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	28	282	1.4e-22	0.977491961414791

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.14e-19	28	278	47	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.64e-07	146	282	147	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPT50359.1|GH17	1.57e-116	16	286	17	288
UIZ21797.1|GH17	7.02e-110	20	289	566	837
UIZ21931.1|GH17	1.25e-76	1	286	1	288
UIZ21795.1|GH17	3.64e-54	1	200	1	202
CCA18992.1|GH17	3.49e-46	28	286	22	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	1.08e-08	38	288	51	297	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8MXP5|BTGE_ASPFN	5.42e-13	28	231	348	555	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1
sp|Q2US39|BTGE_ASPOR	5.42e-13	28	231	348	555	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
sp|A1C499|BTGE_ASPCL	1.23e-12	20	234	300	521	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|A1DBG6|BTGE_NEOFI	2.82e-11	28	234	297	508	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|Q5AUT0|EGLC_EMENI	5.75e-11	68	262	74	287	Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=eglC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000284	0.999682	CS pos: 22-23. Pr: 0.9656

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_526895-t26_1-p1.