CAZyme Information: PHYSODRAFT_526758-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_526758-t26_1-p1
• CAZy Family: GT66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342	JH159161|CGC5	37133.16	4.1007

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159161:934962-936053(+)

Full Sequence      

MKAFVLPLVAFAGLVTGLAPSTEEAENARIEPPAGAIVVDATGDYDGSYLTVSEGMESLD
VTTTEVQTIFVMPGVYKEQVLIPALAGALVLQGSTRDARSYEDNEVTITQAKAQKDLPAH
VTKGRNDLTSTMRFKASNVTVYNLNIANTAGNVGQAVAATVDGTDYGFYGCNFTGYQDTL
YANKGRQLYAQSYISGAIDFIFGSKATAWFESCDIESFGRGCITANGRSTEENPSFYVFN
DAKVFGAGAKGSAYLGRPWRPFARVVFQNSELDDIINPAGWSAWDAASSTEDVYFREFNN
TGDGAATDDRVEFSLELKKPVPMTEILGEDFESEWWVDTDYL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	44	316	2.6e-78	0.9166666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178113	PLN02497	3.83e-51	34	317	31	306	probable pectinesterase
178051	PLN02432	2.14e-50	33	317	9	272	putative pectinesterase
215367	PLN02682	1.05e-49	23	317	59	347	pectinesterase family protein
178372	PLN02773	1.75e-49	38	318	6	283	pectinesterase
178098	PLN02480	1.09e-47	37	319	50	321	Probable pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54869.1|CE8	2.48e-152	7	342	6	338
ACO54873.1|CE8	3.18e-152	1	342	1	344
ABQ63096.1|CE8	4.51e-152	1	342	1	344
ACO54868.1|CE8	3.75e-148	7	342	6	343
AFM08806.1|CE8	3.99e-144	4	342	3	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	7.47e-66	29	341	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	7.47e-66	29	341	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	2.69e-33	33	311	7	279	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	2.66e-30	34	313	3	277	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	5.05e-14	135	305	155	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	1.48e-84	29	342	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	3.36e-83	29	341	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|B8NPS7|PMEA_ASPFN	5.12e-69	26	341	25	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|Q2UBD9|PMEA_ASPOR	1.02e-68	26	341	25	324	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	2.96e-68	19	341	19	325	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000464	0.999496	CS pos: 17-18. Pr: 0.9717

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_526758-t26_1-p1.