CAZyme Information: PHYSODRAFT_526174-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_526174-t26_1-p1
• CAZy Family: GT62
• CAZyme Description: glycosyl hydrolase family 17-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288		31186.99	6.5933

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159161:1597415-1598281(+)

Full Sequence      

MVSLLNIAVVAAVSSVAAGTADARKLSSGVCYAPWHHPTVNWDVLAGDMNQVSQHFSSIR
TYQAQFNGVNAISMAAAAGLHIAVGVQLTDPRWIDAEIQAVCDGYAKNAWAVEAVYVGNE
DLKNGNFGTYSADQIAGYIRRVKQCVGNTPVGSAQRINEWLGADSAWALANACDVIGVNI
HPFFTPGSQPAVKKLEAQWNQMTSKFGSAKVRLTETGWPYAGSSYAGNVPSTGAMTQFFY
DYVYGWCPGKSQSYWFMMYDTTVSYSGADYEKHFGLFGTDKSQHISLP

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_526174-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	29	283	4.1e-16	0.9742765273311897

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.99e-21	43	281	63	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	0.002	203	287	219	307	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPT50359.1|GH17	4.41e-162	1	288	1	288
UIZ21797.1|GH17	9.75e-96	21	288	566	834
UIZ21931.1|GH17	1.70e-93	1	288	1	288
UIZ21795.1|GH17	9.08e-70	1	201	1	202
CCA18992.1|GH17	2.27e-39	29	288	22	282

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	8.36e-11	38	282	50	287	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	5.07e-10	38	282	50	287	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBG6|BTGE_NEOFI	5.04e-13	44	230	315	503	Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgE PE=3 SV=1
sp|Q2US39|BTGE_ASPOR	4.17e-12	29	232	348	555	Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgE PE=3 SV=1
sp|B8MXP5|BTGE_ASPFN	4.17e-12	29	232	348	555	Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgE PE=3 SV=1
sp|A1C499|BTGE_ASPCL	1.95e-09	53	231	337	517	Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgE PE=3 SV=1
sp|Q04951|SCW10_YEAST	5.18e-08	27	231	136	342	Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SCW10 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000241	0.999723	CS pos: 18-19. Pr: 0.9617

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_526174-t26_1-p1.