CAZyme Information: PHYSODRAFT_523224-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_523224-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	JH159159|CGC5	45543.51	4.8114

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159159:1037447-1038655(+)

Full Sequence      

MYTRSVCSRIRAHTPETDSQPLICPSLDDLQAQLQQKFRRLEASRAINRAFMELWRYSLF
DSDPELPPFIIAYSDNAVFSSIVLECLFVIIHEPQKRPILVMPESTLHEYYGGTPDVYVF
SILDGDCDPVARPACQEGIAQHFRNYGQGPKPATIMMVAGEPISTQGLDERVILLSTVSV
VDHERHVYFSVASNSFAERLDHSPTALLSPSPAYMEQEAVDSRRFCAYLYARCDRPQREY
MFDVLNAMEPVDALGICAGSSRLPDASYGASRYSDWYNDDAVTTFQRYKFVIAFENSGVP
GYVTEKLVNPFLAGSIPIYLGNSTTVSELFNPNSFIDCGRFERLRDCADYVVKVHRSPEL
YDQMQREPPIRDVEAFNEAFSWHPSVPSRDLADKVAKLMQIT

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_523224-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	218	366	1.9e-37	0.3976945244956772

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395683	Glyco_transf_10	1.58e-17	237	361	17	130	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR32886.1|GT10	1.87e-21	225	368	128	265
ANU61948.1|GT10	1.87e-21	225	368	128	265
ASB35439.1|GT10	1.87e-21	225	368	128	265
QNB42929.1|GT10	4.78e-21	225	368	128	265
AEJ34901.1|GT10	1.35e-20	224	368	70	211

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	1.38e-15	201	374	147	317	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	1.05e-14	201	374	147	317	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5UQ63|YR654_MIMIV	5.45e-20	224	368	425	566	Putative fucosyltransferase R654 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_R654 PE=3 SV=1
sp|O30511|FUCT_HELPX	1.16e-14	201	374	147	317	Alpha-(1,3)-fucosyltransferase FucT OS=Helicobacter pylori OX=210 GN=fucT PE=1 SV=1
sp|Q6A1G3|FUT10_XENTR	3.65e-12	227	363	207	341	Alpha-(1,3)-fucosyltransferase 10 OS=Xenopus tropicalis OX=8364 GN=fut10 PE=2 SV=1
sp|Q9VLC1|FUCTB_DROME	2.54e-11	228	366	175	313	Alpha-(1,3)-fucosyltransferase B OS=Drosophila melanogaster OX=7227 GN=FucTB PE=2 SV=2
sp|Q6NTZ6|FUT10_XENLA	3.60e-11	227	363	205	339	Alpha-(1,3)-fucosyltransferase 10 OS=Xenopus laevis OX=8355 GN=fut10 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000038	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_523224-t26_1-p1.