CAZyme Information: PHYSODRAFT_522084-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_522084-t26_1-p1
• CAZy Family: GT60
• CAZyme Description: polygalacturonase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
434		47014.90	9.1480

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159159:1728475-1729876(+)

Full Sequence      

FLRLFAVSLLVASTTIIDAGTNNLPQVQVDSSSDYKQGEVMPADQTAASSAEVSQESPTQ
GNPSQTNSGNYDPAQHSGSYGESQKQTPPVFTGKCTLTGDYVNNTDVSACNTIVIDSLRV
PAGVQLNLTQLQDNAKIKFQGTSTFGPKLWSGPLVKVRGNNITVTGPGTLDGQGAWCWPQ
GRKVTKPVSFRILETNYSTFSGFKMLNMPYRTFNVWDSSYTTINGLTLNSSAGDGVAKNT
DGFDLSRNNHLTITKNRIYNQDDCLAMQSSANTVYSDNYCSGSHGISIGSLGGPVLNSSY
TVNGLKVTGNTIVNSTNGIRIKTTIDLQGLVTNAVYTNNQLVNVTNAIVMHSDYNKTKGG
YSGKPTSLVAIKNIKINGLKGTATNLYDLLVTVKEKSQQQVYFLAIPFLRVLCSTRRRGR
EKIYVLLLLFFYCD

Enzyme Prediction     

EC	3.2.1.15:10

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	107	385	2.8e-53	0.8461538461538461

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.67e-66	110	385	1	279	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	1.49e-23	148	395	122	360	polygalacturonase
215120	PLN02188	4.89e-23	160	386	122	351	polygalacturonase/glycoside hydrolase family protein
215426	PLN02793	2.09e-20	160	383	143	368	Probable polygalacturonase
177865	PLN02218	1.19e-17	160	383	156	382	polygalacturonase ADPG

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAN05464.1|GH28	2.89e-182	53	390	26	355
AAN05463.1|GH28	6.42e-173	1	390	4	380
UKP15072.1|GH28	6.42e-173	1	390	4	380
AAN05460.1|GH28	7.72e-169	83	390	112	419
AAN05462.1|GH28	1.26e-167	83	390	112	419

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IA5_A	4.96e-55	95	385	4	297	Polygalacturonase From Aspergillus Aculeatus [Aspergillus aculeatus],1IB4_A Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus],1IB4_B Crystal Structure of Polygalacturonase from Aspergillus Aculeatus at Ph4.5 [Aspergillus aculeatus]
6KVE_A	2.33e-53	95	389	11	310	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
7E56_A	2.65e-53	95	389	3	302	Chain A, Endo-polygalacturonase [Evansstolkia leycettana]
1HG8_A	3.72e-53	95	385	3	307	Endopolygalacturonase from the phytopathogenic fungus Fusarium moniliforme [Fusarium verticillioides]
6KVH_A	1.26e-52	95	389	11	310	Chain A, endo-polygalacturonase [Evansstolkia leycettana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CMU3|PGLR1_ASPTN	5.42e-54	92	382	32	323	Probable endopolygalacturonase I OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pgaI PE=3 SV=1
sp|P26215|PGLR_COCCA	6.86e-54	95	384	30	321	Polygalacturonase OS=Cochliobolus carbonum OX=5017 GN=PGN1 PE=3 SV=1
sp|O74213|PGLR1_ASPAC	6.96e-54	95	385	43	336	Endopolygalacturonase I OS=Aspergillus aculeatus OX=5053 GN=pgaI PE=1 SV=1
sp|Q12708|PGLR1_SCLSC	1.03e-53	93	389	44	349	Endo-polygalacturonase OS=Sclerotinia sclerotiorum OX=5180 GN=PG1 PE=3 SV=1
sp|B8N8M2|PGLR1_ASPFN	2.85e-53	95	385	34	325	Probable endopolygalacturonase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pgaI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000343	0.999634	CS pos: 19-20. Pr: 0.9785

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_522084-t26_1-p1.