CAZyme Information: PHYSODRAFT_521418-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_521418-t26_1-p1
• CAZy Family: GT58
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342		37700.90	6.2323

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159159:1283881-1284909(-)

Full Sequence      

MRIFDLLLVSFVASAAADYTCSGPDARTQPPVGAFVVDHTGAYSGSFRNISEAVAHVPNN
TDEHTIFLFPGVYREQVLVSKLNGPLVMQGYTCNTKSYAANEVTITHSKAQRDIPPEITS
GRNDLTSTLRLKTNNMKVYNLNLANTAGYIQKNGQAVATIVEGNNYGFYACNFTSYQDTV
YANMGRQLFAHSYISGAIDFVFGLRGEAWFESCDIDTIGPGSITANGRVNESSPSYFVFN
NARVFSSSGNGSAFLGRPWRPYSRVVWQNSELGDVVNAEGWQLWHNDTNIANVYYREFNN
RGPGAAKDKRVSFSAQLDAAVPATKILGENYTSEWWVDNAFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	43	320	3.6e-74	0.9270833333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	6.20e-50	36	314	3	275	Pectinesterase.
178051	PLN02432	8.02e-49	37	325	15	283	putative pectinesterase
178113	PLN02497	1.25e-43	36	320	35	309	probable pectinesterase
215130	PLN02217	2.23e-42	44	313	259	524	probable pectinesterase/pectinesterase inhibitor
178346	PLN02745	6.96e-41	44	311	294	557	Putative pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ63096.1|CE8	1.01e-204	1	342	1	344
ACO54873.1|CE8	2.90e-204	1	342	1	344
ACO54871.1|CE8	8.05e-182	1	341	1	343
ACO54869.1|CE8	7.92e-156	1	342	1	338
ACO54875.1|CE8	2.00e-153	1	342	1	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	5.42e-56	25	341	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	7.63e-56	25	341	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	1.39e-33	44	313	16	281	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	3.69e-31	44	313	12	277	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	2.67e-07	136	305	159	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	1.99e-73	27	341	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	1.77e-68	6	342	6	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q5B7U0|PMEA_EMENI	2.02e-62	26	338	28	322	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1
sp|B8NPS7|PMEA_ASPFN	2.77e-62	6	341	10	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	5.51e-62	27	341	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000351	0.999635	CS pos: 17-18. Pr: 0.9703

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_521418-t26_1-p1.