CAZyme Information: PHYSODRAFT_520929-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_520929-t26_1-p1
• CAZy Family: GT57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	JH159158|CGC15	43723.08	6.1747

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159158:2539560-2540792(+)

Full Sequence      

MGRLQLLVAAALAFVGPSAHAVTIGSPIGMGSGTTGGGDVAPVYPNTTKELVAYLRDPAP
KVVVLTKTFDFRGLAGNTTAEGCRPNYMRKCIALNNGFKGQDVILQDGGMNNTGGCTDGT
SVNVTYDNASLNRINVRGNKTIRGVGNSGVIMGKGLNLNGHNIIVQNVHITEINPHLVWG
GDAITMQGLSDGTVPLEHIWLDHIKISRIGRQFIAVAKAGVASMTISNSDFDGHTEFSKT
CDGHHYWSFIFDGKTTGITMVNNYIHYLSGRLPKVGGSSDISVVTHIANNYYKDNSYHSM
EIGTNGYVLAEGNYFVNTTQPLYDGDDPDIPGMVDGSLYAPLQSSEDECTASLGRLCEEN
VLEDSGAFGSRNGTTALAEMKPHPTVARFSPKQAQQLELSTTNFGVGELN

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	123	317	5.1e-79	0.9946524064171123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	4.81e-32	122	318	2	189	Amb_all domain.
226384	PelB	4.19e-12	97	332	51	290	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	3.06e-10	127	315	23	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74066.1|PL1_4	6.14e-251	1	409	1	409
ACR19246.1|PL1_4	2.50e-250	1	409	1	409
ADN18834.1|PL1_4	1.27e-170	6	410	7	400
AHX74068.1|PL1_4	3.62e-170	6	410	7	400
ADN18833.1|PL1_4	5.27e-165	1	410	1	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDJ_A	4.21e-75	25	381	5	333	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	5.93e-75	25	381	5	333	Pectin Lyase A [Aspergillus niger]
1QCX_A	5.93e-75	24	396	4	357	Pectin Lyase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CYC2|PELA_NEOFI	2.55e-84	18	368	15	340	Probable pectin lyase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pelA PE=3 SV=2
sp|Q0CZD4|PELF2_ASPTN	1.19e-83	11	370	10	343	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|B8N316|PELF_ASPFN	1.55e-83	6	372	7	347	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	1.55e-83	6	372	7	347	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|Q4WIS6|PELB_ASPFU	2.02e-83	18	368	15	340	Probable pectin lyase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pelB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999750	CS pos: 21-22. Pr: 0.9774

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_520929-t26_1-p1.