CAZyme Information: PHYSODRAFT_520924-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_520924-t26_1-p1
• CAZy Family: GT50
• CAZyme Description: putative glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243		26119.04	4.4965

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159158:3313901-3314632(+)

Full Sequence      

MKLSVAIAFAAAAVAAPPAVAKEFCDLWGSAQTDDYTVYNNLWGAHDDPKGGQCTELDSV
DGSNIAWHTSFNWNGSSWQVKSFANAALKFEPVQLANISSIPSTIEYDYKYDGKIITNVA
YDLFTSATANGTVEYELMVWLAALGGAWPLTTSGRPIKAVNVGGTDFNLYQGKNGNTTVF
SYVAVNSTTKFSADFKQFFSELPADNTIAPTQFLTHVQAGTEPFQGQNATLTVSKYSVAV
NSA

Enzyme Prediction     

EC	3.2.1.151:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	92	240	1.2e-40	0.9871794871794872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	1.32e-39	36	241	3	207	Glycosyl hydrolase family 12.
235746	PRK06215	2.31e-13	25	196	41	193	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB22025.1|GH12	2.72e-177	1	243	1	243
ABB22034.1|GH12	3.27e-146	1	243	1	242
ABG91065.1|GH12	5.45e-136	1	242	1	243
ABB22033.1|GH12	3.78e-115	1	242	1	241
AAT66504.1|GH12	9.92e-113	1	243	1	241

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4NPR_A	8.32e-72	19	240	22	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
3VLB_B	1.39e-70	23	240	6	221	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
3VL8_A	1.74e-70	23	240	13	228	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
6K9D_A	3.80e-48	22	241	1	218	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]
6K98_A	3.12e-47	21	241	1	219	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|W2PDG1|XLP1_PHYPN	5.96e-80	18	241	15	238	Inactive glycoside hydrolase XLP1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XLP1 PE=1 SV=1
sp|Q5BG78|XGEA_EMENI	3.29e-77	1	241	1	239	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|B8N3L3|XGEA_ASPFN	3.91e-76	23	240	23	239	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xgeA PE=3 SV=1
sp|Q2UK93|XGEA_ASPOR	3.91e-76	23	240	23	239	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=xgeA PE=3 SV=1
sp|G4ZHR2|XEG1_PHYSP	6.58e-75	9	241	5	241	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora sojae (strain P6497) OX=1094619 GN=XEG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000220	0.999746	CS pos: 21-22. Pr: 0.9756

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_520924-t26_1-p1.