CAZyme Information: PHYSODRAFT_520882-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_520882-t26_1-p1
• CAZy Family: GT49
• CAZyme Description: putative glycosyl hydrolase family 5 member

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438	JH159158|CGC7	48471.23	4.4095

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159158:3123487-3124923(+)

Full Sequence      

MLRRLACLTAALAALTVNPTAATDFNTLGSDYNAVAQVQATDDVSHDTTQQQQSTTGSAT
QTTHIQYSIRNGDVSSIGVNLGSWLVAEHWMTSAADFWQGVSDEDAGKGEYTAITKASDP
DTIRSNLDYHHSTFITEKDIAEIAAAGLNTVRVPVGYWIVGFDNDDPSGQAAWAQYSNGT
LKYLDALVTNWANKHNIAVLFSLHAAKGSQNGADHSSPCDPGNSHWSAYDENVANTVSLA
TFLADRYKDEDAFLGIGLLNEPNASTDEDKLYAYYEKAYAAIRTLSDCVLSVAPLLYKQS
PDVMTDFMQAPAYTNVWVEWHPYFVWGYESTSEYDLTNTAVKTNFQNSVSQWNARENHNR
LFIGEWSFATAGKFGDDQEGYYEFCKAMVDVMYQAGGGFTFWSWRLYGDESGFNAWSLRS
VLRDTRLKSIFFPNAAQS

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_520882-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	128	405	1.1e-46	0.9566787003610109

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	5.44e-21	78	367	20	322	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.13e-05	134	404	24	268	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29069.1|GH5	1.51e-187	1	436	1	418
UIZ29004.1|GH5	3.76e-155	59	430	31	405
CCA17636.1|GH5	4.09e-117	64	424	126	491
UJR33211.1|GH5	4.94e-106	64	422	29	381
UIZ29723.1|GH5	2.67e-105	69	428	5	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EQP_A	1.64e-27	78	405	11	360	Exo-b-(1,3)-glucanase From Candida Albicans [Candida albicans]
3O6A_A	1.75e-27	78	405	16	365	F144Y/F258Y Double Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	2.24e-27	78	405	11	360	Exo-b-(1,3)-glucanase From Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]
2PB1_A	2.43e-27	78	405	17	366	Exo-B-(1,3)-Glucanase from Candida Albicans in complex with unhydrolysed and covalently linked 2,4-dinitrophenyl-2-deoxy-2-fluoro-B-D-glucopyranoside at 1.9 A [Candida albicans]
3N9K_A	4.48e-27	78	405	16	365	F229A/E292S Double Mutant of Exo-beta-1,3-glucanase from Candida albicans in Complex with Laminaritriose at 1.7 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q96V64|EXG_BLUGR	1.03e-30	78	405	39	385	Glucan 1,3-beta-glucosidase OS=Blumeria graminis OX=34373 PE=3 SV=1
sp|Q5B5X8|EXGA_EMENI	8.77e-29	78	283	31	222	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
sp|Q4WK60|EXGA_ASPFU	1.02e-28	78	434	44	413	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=exgA PE=3 SV=1
sp|B0XN12|EXGA_ASPFC	1.02e-28	78	434	44	413	Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=exgA PE=3 SV=1
sp|O93983|EXG2_WICAO	1.62e-28	78	369	44	320	Glucan 1,3-beta-glucosidase 2 OS=Wickerhamomyces anomalus OX=4927 GN=EXG2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000991	0.998953	CS pos: 22-23. Pr: 0.9698

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_520882-t26_1-p1.