CAZyme Information: PHYSODRAFT_518742-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_518742-t26_1-p1
• CAZy Family: GT48
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347	JH159158|CGC17	37511.99	6.8384

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159158:1400437-1401480(+)

Full Sequence      

MRSFALPLVAFAALAASAFASPDAACSGPNARTVPPAGALVVDATGAHPGSFPTVSQAVA
KVVNNTEEHTIFVLPGVYHEQVVVPPLNGPLVLQGYTCNTMTYADNQVTITQAKAQRDIP
AEIKDERNFLTTTLGLRGKNIKVYNLNIANTAGQIQQSGQAVAVYLNDTNYGFYGCNISS
YQDSLCAHMGREIYARSYIAGAVDFIFGLQAKAWFESCDIESVGKGYITANGNGNSSNLS
EYIFNRARVFGSSGNGSTYLGRPWRPYSRTVFMNSEISNVVNPKGWALWNAVSPTNNIFY
KEFNNSGPGADTSQRAPFSGKLDAPYPITNTLGENYASEWWVDTKFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	48	321	5.7e-75	0.9131944444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	1.67e-54	43	320	1	276	Pectinesterase.
178051	PLN02432	3.31e-47	36	322	9	272	putative pectinesterase
178113	PLN02497	4.21e-45	37	324	31	308	probable pectinesterase
178372	PLN02773	8.36e-45	35	322	2	282	pectinesterase
215383	PLN02713	7.75e-43	30	320	242	529	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABQ63096.1|CE8	2.51e-162	1	347	1	344
ACO54873.1|CE8	7.18e-162	1	347	1	344
ACO54874.1|CE8	3.76e-160	1	347	1	348
ACO54875.1|CE8	4.70e-158	1	347	1	346
ACO54870.1|CE8	4.36e-154	1	347	1	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	2.47e-55	30	346	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	3.48e-55	30	346	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	9.47e-39	40	320	9	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	7.65e-34	50	320	13	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	3.68e-08	52	310	48	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	1.86e-72	32	346	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	1.85e-69	32	347	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	5.04e-61	32	346	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	5.04e-61	32	346	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	4.83e-58	32	346	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999733	CS pos: 20-21. Pr: 0.9631

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_518742-t26_1-p1.