CAZyme Information: PHYSODRAFT_513690-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_513690-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437	JH159156|CGC3	46620.01	7.0002

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159156:2026636-2028006(-)

Full Sequence      

MGRLQLAIAAALALVAKSANAFTIGTAPGLAAGATGGAAGKTVYPTTTTELISYLNSSEP
LVVVLNKTFDFRGTEGTTTEPGCRPDYTRACMAKNNGFKSQDVILQQGGMNNTGGCTGGT
SVTVTYDNAPLKRMNVKGNKTIRGIGKSGVIIGKGLTLAGDNIIVQNIHITELNRHLVWG
GDAIYLQGLDHGKTAMKNIWLDHIKVSHVGRQFLTTNMASTDSLTISNSDFDGNTDYSAS
CDGHHYWSFIFYGTTQFSMLNNYVHGTSGRSPKIGGEPDIRVVAHVANNFWGNNSGHSFE
IGANAWVLAEDNYFSNTRMPLFNKTNDGALYAAGSADECSKFLGRACKANVLVNSGIFPS
RNGETALETIKSVPTFANGLDQQQQQQQQQQQEQVEQSTAGTVKPSSVQAGQTSIQASEV
ESVWAETTSYFGVGKLD

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	123	316	1.7e-76	0.9946524064171123

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	6.63e-32	122	318	2	190	Amb_all domain.
226384	PelB	1.21e-11	123	321	84	280	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74069.1|PL1_4	1.00e-191	1	437	1	441
ADN18835.1|PL1_4	4.05e-191	1	437	1	441
ACR19258.1|PL1_4	1.13e-190	1	332	1	331
AHX74068.1|PL1_4	2.47e-182	10	372	10	372
ADN18834.1|PL1_4	2.47e-182	10	372	10	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	2.13e-69	24	356	4	320	Pectin Lyase B [Aspergillus niger]
1IDK_A	4.63e-68	25	358	5	321	Pectin Lyase A [Aspergillus niger]
1IDJ_A	3.93e-66	25	358	5	321	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJA7|PELF_ASPOR	1.47e-85	11	376	10	372	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	1.47e-85	11	376	10	372	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|B8NVB7|PELD_ASPFN	2.38e-82	13	356	12	338	Probable pectin lyase D OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelD PE=3 SV=1
sp|Q2TXS4|PELD_ASPOR	2.38e-82	13	356	12	338	Pectin lyase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pel2 PE=1 SV=1
sp|Q5BA61|PELB_EMENI	3.32e-80	3	358	2	341	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999769	CS pos: 21-22. Pr: 0.9767

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_513690-t26_1-p1.