CAZyme Information: PHYSODRAFT_513650-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_513650-t26_1-p1
• CAZy Family: GT31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
449	JH159156|CGC7	48041.43	7.9889

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159156:1623380-1624846(-)

Full Sequence      

MRLQFAIAAVLALVAKNANAFSVGSPEGLAAGATGGAGGKTVYPKSTSELVSYLASSEPL
VVVLNKTFDFRGTEGTTTETGCRPDYTRECMAKNNGYKSQDVIIQGGNMATTGGCTGGTK
VKITYDNAALKRMTVTGNKTIRGIGKSGVIKGKGLTLNGNNIIIQNVHITELNRHLVWGG
DAIYLQGLDHGKTAMKNIWLDHIKVSHVGRQFLTTNMASTDSLTISNSDFDGNTDYSASC
DGHHYWSFIFYGVTKFSMLNNYIHGTSGRSPKIGGDSAAKVVAHVANNFWGNNTGHSFEI
GANAWVLAEGNYFSNTMMPLFTGKDGALYAASSQDQCKSLLGRACVANELVDSGAFESRN
GETALKTVKSVSTFIEYTPGSTGSGGSQQQQQSSKAEQQQEQQQEQQQTAQTSGYKQEES
QSRRLAGQTSDLEKEWQQTTGNFGVGKLD

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	123	315	5e-78	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	8.97e-35	120	316	1	189	Amb_all domain.
226384	PelB	1.30e-13	96	320	51	280	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19258.1|PL1_4	8.95e-205	1	332	2	333
ADN18834.1|PL1_4	1.71e-190	9	381	10	383
AHX74068.1|PL1_4	2.42e-190	9	381	10	383
AHX74069.1|PL1_4	8.92e-179	1	449	2	441
ADN18835.1|PL1_4	3.61e-178	1	449	2	441

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	6.03e-76	23	355	4	321	Pectin Lyase B [Aspergillus niger]
1IDK_A	1.60e-72	24	356	5	321	Pectin Lyase A [Aspergillus niger]
1IDJ_A	5.39e-70	24	356	5	321	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B8N316|PELF_ASPFN	7.95e-92	12	385	12	385	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	7.95e-92	12	385	12	385	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|Q5BA61|PELB_EMENI	3.47e-83	1	385	1	377	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|A2R6A1|PELF_ASPNC	5.01e-83	24	385	26	381	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	5.01e-83	24	385	26	381	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000192	0.999775	CS pos: 20-21. Pr: 0.9799

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_513650-t26_1-p1.