CAZyme Information: PHYSODRAFT_504257-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_504257-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509		58035.75	6.4671

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159154:7441388-7442917(+)

Full Sequence      

MPLDSSDPEANIRAEAEAHARSVHVLPSGETKTRSLRCIGWRNTGDCNPDGPREPHKDLT
CYDFVPNNASGYCEVEDTKSGERFRVMRHSCNVLRNRVPFRCINAPAFARFRVQAHQALP
TPDFRLPNVAVSTQPPRDGIVMVVYPKLAPSAYATIRALRDILHCSLPIEIWLRPDEMEL
APEALAPLQHLAQNTSVGDISFHPITDPEAKRFVAKIYAIYHSSFDRVLFLDADNVPVRD
PRFLFDSREFERTGAVFWPDFWHPSSTMFGLHNKSLLWELLDMPFVDMFEQESGQLVVDR
RRHAAPLELVMFYATHNPNFLVHYRLAWGDKDLFRLAWLKLKATFHMIKTPPAMAGVVTN
TSAFCGMTMVQHDANGEVLFLHRNKHKLTGTNDATIPDEEDSETEHEVDSTSVAFDRSVH
DVEVGGYPDPAIWRHLMSFDRNSSRDQYVIEAFATPLDFTIKQKCFGRRSLSKSLQFHVQ
EFADFPFDGLETDLRHFAKEAAEKLRGQS

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_504257-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	138	373	1.8e-53	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	6.73e-42	138	373	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	1.22e-04	201	269	66	142	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28119.1|GT71	8.68e-137	142	503	1	356
CCA25989.1|GT71	1.06e-100	38	494	98	532
UIZ27901.1|GT71	1.88e-98	29	393	57	424
UIZ24000.1|GT71	3.18e-93	24	506	92	572
UIZ24059.1|GT71	4.36e-93	38	506	143	600

PDB Hits     

PHYSODRAFT_504257-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6ZQE9|MNN5_YEAS7	2.40e-16	138	373	150	433	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|P46982|MNN5_YEAST	2.40e-16	138	373	150	433	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|P38069|MNN2_YEAST	7.31e-15	138	373	171	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|Q5AP90|MNN23_CANAL	8.91e-13	139	373	175	449	Alpha-1,2-mannosyltransferase MNN23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN23 PE=3 SV=2
sp|Q59KJ7|MNN21_CANAL	2.74e-11	137	348	245	500	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999414	0.000620

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_504257-t26_1-p1.