CAZyme Information: PHYSODRAFT_503773-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_503773-t26_1-p1
• CAZy Family: GT20
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
311	JH159154|CGC15	34178.42	3.7533

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159154:4228660-4229595(+)

Full Sequence      

MKLFVIALSSGLLNEVNAWWKPTPGTSYQIQLSGTLDLSYDADMYDIDMFDTLNTTIAEL
QQRGIKVICYSSAGTYEDWRSDKDQYSADIIGTPLDEWEGESWVDIRSPKLREIVTNRMK
LAQAKGCDSVDPDNVDSAFNDNGFDLTAADQLDFNTFLATTAHELDLTVGLKNDLDQIDD
LVSSFDFSVNEQCVQYDECDTLAPFIEQDKPVFGIECSGGKATACATANSLDFDTLFKTL
SLQSERYSCRDMSGDSSLGSTMSEDSDAKSGLMDESEERNGSSDNNSGSTSWTSSGNVLL
LVGLAAWAYED

Enzyme Prediction     

EC	3.2.1.109:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	28	216	1.7e-73	0.9894736842105263

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	9.40e-99	27	242	1	219	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	1.06e-33	29	249	64	304	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
225219	COG2342	8.18e-04	29	216	33	250	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADO71463.1|GH114	7.26e-89	18	250	81	315
ADD68031.1|GH114	1.41e-83	9	250	19	261
AKU96720.1|GH114	2.13e-81	20	250	77	309
AJQ96182.1|GH114	3.65e-81	18	249	61	300
SQD79242.1|GH114	3.70e-78	15	249	94	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	3.54e-70	14	242	28	270	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	5.94e-70	14	242	45	287	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

PHYSODRAFT_503773-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000333	0.999668	CS pos: 18-19. Pr: 0.9740

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_503773-t26_1-p1.