CAZyme Information: PHYSODRAFT_503290-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_503290-t26_1-p1
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
387		42936.17	5.7484

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159154:3462594-3464106(+)

Full Sequence      

MCKAGGFESLFPMQELSLMGLVEVVPYLWRFRRRIQDTLRDIEAYQPELVLTIDSKGFTF
RVLKALQASEQQSGGKRIKKAHYVAPSVWAYKHRGKRDFTELQQLLDAMFTILPFEEDIF
RAGESSQRLESGEEGATQSWCHFVGHPAVEDFLEAHGAFDRIPDYEGASAETDARQLEIG
ADALLDLSKLDMSNLLERGQFFHALAARGREPNSRAQARKEFGVPDDAFVICALVGSRAN
EVKKSARLVLNAIAEFKQTNASMREKNIRVVFPTIAAVEDQVNAYISVAFPEVKCQVLTD
LDAAARFRLFQGSDLALAVSGTIVLETTLANLPTVVIYCANKVTEWIAQRLAAVRFVSVP
NLLLGRSLLPELLFSECTASNIASALG

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	1	386	1.4e-68	0.8192090395480226

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
234580	lpxB	1.46e-69	3	386	42	335	lipid-A-disaccharide synthase; Reviewed
223834	LpxB	8.65e-68	1	386	41	338	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
397004	LpxB	1.74e-57	4	386	40	335	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
129319	lpxB	4.65e-38	4	386	47	341	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
167141	lpxB	1.22e-20	3	373	267	551	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAF06181.1|GT19	1.34e-44	6	386	88	403
BAG94820.1|GT19	1.34e-44	6	386	88	403
BAS74376.1|GT19	1.34e-44	6	386	88	403
BAD87183.1|GT19	1.34e-44	6	386	88	403
QHO33836.1|GT19	1.20e-43	6	386	88	405

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	3.65e-25	3	386	47	341	Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	5.00e-25	3	386	47	341	Lipid A Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F4IF99|LPXB_ARATH	3.56e-44	1	386	80	399	Probable lipid-A-disaccharide synthase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=LPXB PE=2 SV=1
sp|Q0BS63|LPXB_GRABC	5.13e-43	6	386	47	337	Lipid-A-disaccharide synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) OX=391165 GN=lpxB PE=3 SV=1
sp|Q5LSU1|LPXB_RUEPO	2.43e-37	6	386	60	359	Lipid-A-disaccharide synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=lpxB PE=3 SV=1
sp|Q2W4D7|LPXB_MAGSA	5.30e-37	3	386	42	338	Lipid-A-disaccharide synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) OX=342108 GN=lpxB PE=3 SV=1
sp|B6IST7|LPXB_RHOCS	1.24e-35	6	386	48	340	Lipid-A-disaccharide synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) OX=414684 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000085	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_503290-t26_1-p1.