CAZyme Information: PHYSODRAFT_499026-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_499026-t26_1-p1
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
403		46286.95	8.8025

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159154:7513469-7514746(+)

Full Sequence      

MKRTCADTFRGASIRCSDAPGFANFRANAQLRQGIVIVVYPELVASTYATVRALRDELGC
SLPIEIWLRRDEMNKVPGVLEPLWDLARNKSGGEITFQAIRHQHALQFNSKIYAIYHSKF
EQVLFLDADNVPVRDPSYLFSTPEFVKTGAVFWPDFWHPGQTIFFINPSSLVWQLLDMPF
VDMFEQESGQLLIDRKRHAAPLALVTFYAFHQPNYFRRLHLAWGDKDLYRFAWLKLGASF
HMIKTPPAVAGELKRDLFCGMTMAQHDPSGDVIFLHRNQLKLTGEAKLQDFDPRLKSALA
TVPQNAAQATAQDNGYPDPEIWTHLVSFRDTSPRSEYIIEKHVSVNKLTGIQRCFGGREL
HKNPNFYTQEFTDFSYAELEFHLRRFAKKAAELRQRKISQPAT

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_499026-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	33	267	1.8e-51	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	1.24e-41	34	267	3	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	7.59e-06	120	178	90	148	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28119.1|GT71	2.71e-121	37	393	1	357
UIZ24000.1|GT71	8.32e-83	32	393	246	570
CCA25989.1|GT71	3.68e-80	32	283	213	461
UIZ24059.1|GT71	1.33e-79	32	399	852	1182
UIZ27901.1|GT71	9.16e-77	13	284	134	421

PDB Hits     

PHYSODRAFT_499026-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59KJ7|MNN21_CANAL	2.08e-16	32	275	245	534	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1
sp|P38069|MNN2_YEAST	1.09e-15	108	267	247	440	Alpha-1,2-mannosyltransferase MNN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN2 PE=1 SV=1
sp|P46982|MNN5_YEAST	1.44e-13	33	291	150	455	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN5 PE=1 SV=2
sp|A6ZQE9|MNN5_YEAS7	3.40e-13	33	291	150	455	Alpha-1,2-mannosyltransferase MNN5 OS=Saccharomyces cerevisiae (strain YJM789) OX=307796 GN=MNN5 PE=3 SV=1
sp|Q5A687|MNN22_CANAL	7.94e-12	57	279	186	449	Alpha-1,2-mannosyltransferase MNN22 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN22 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_499026-t26_1-p1.