CAZyme Information: PHYSODRAFT_498045-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_498045-t26_1-p1
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241	JH159154|CGC9	27124.57	10.6484

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159154:909925-910968(-)

Full Sequence      

MAGTTLLAVYQGLWRASMPLVTWYVRRKDLRRLVPAAITAERFGRSAPPVDTRTDCFTLW
IHGASVGECLSALPLVELALGHKLDQAVAASTGDEKRRVRVVLSTTTTAARQLLSERLKE
NKGAVCVLAPLDHPRCVERFYDAWQPDAGIWIESELWPTLIMEAKRRGVRIGLINGRMSP
ESFRLWRLPGLLELSKRVVGLFSLVLCQDEQNRQRFEFLGARDARTALNLKFGMRSRSPP
S

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_498045-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	40	233	3.1e-44	0.9661016949152542

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398219	Glycos_transf_N	3.03e-55	41	232	2	174	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
224436	KdtA	1.84e-45	6	232	1	208	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
235589	PRK05749	5.42e-45	6	232	2	210	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK39579.1|GT30	1.21e-40	19	231	15	207
BBK34513.1|GT30	2.52e-39	9	231	5	207
CUW37378.1|GT30	2.32e-37	9	234	5	208
CCQ74891.1|GT30	2.53e-37	6	240	2	212
BAE52896.1|GT30	2.40e-36	9	234	5	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XCI_A	1.66e-09	59	232	43	184	Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCI_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, substrate-free form [Aquifex aeolicus],2XCU_A Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_B Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_C Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus],2XCU_D Membrane-embedded monofunctional glycosyltransferase WaaA of Aquifex aeolicus, complex with CMP [Aquifex aeolicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8VZA5|KDTA_ARATH	1.02e-26	3	221	4	204	Probable 3-deoxy-D-manno-octulosonic acid transferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=KDTA PE=2 SV=1
sp|Q1RGU8|KDTA_RICBR	1.62e-22	25	232	26	206	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=waaA PE=3 SV=1
sp|Q9ZE58|KDTA_RICPR	4.98e-21	59	232	93	248	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia prowazekii (strain Madrid E) OX=272947 GN=waaA PE=3 SV=1
sp|Q4UND5|KDTA_RICFE	1.14e-19	59	232	98	253	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=waaA PE=3 SV=1
sp|Q68XV7|KDTA_RICTY	1.54e-19	59	232	95	250	3-deoxy-D-manno-octulosonic acid transferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) OX=257363 GN=waaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_498045-t26_1-p1.