CAZyme Information: PHYSODRAFT_494771-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_494771-t26_1-p1
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
293		30771.99	4.7613

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:8800161-8801371(+)

Full Sequence      

MVKLFAASAALLLATATAASVPDGKWPTSAGSVRLAAAQVVKAGEVFDGKMQTYERSDVS
CEGQTESGADTAVFKLEPGATLKNVIIGKNQMEGVHCDKHDCTIENVWWDDVCEDALSVK
GGSASSVTTVTGGGARSADDKVIQHNGLGTVKIDGFYGEDVGKLYRSCGTCGGKARKVSM
SNVLVVNPTNAVVTVNKNWGDQATLSNIWVKSSGSKKVKICQWSQGNANGEPSMLGDGPS
PSLCQYSESDVHINGNEGGEDTKKDEGEDTRQDDGDNTKQDDGDKKKKGEGDN

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	30	226	1.8e-80	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	4.60e-92	26	230	4	199	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADN18841.1|PL3_2	8.16e-164	1	255	1	254
ADN18837.1|PL3_2	1.41e-113	1	251	1	258
ADN18840.1|PL3_2	3.28e-112	18	251	28	258
ADN18839.1|PL3_2	5.32e-90	1	253	1	275
AHX74070.1|PL3_2	1.07e-89	1	253	1	275

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	3.68e-28	41	181	11	144	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
3B90_A	4.27e-25	53	251	8	223	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
3B4N_A	3.59e-24	53	251	126	341	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4EW9_A	6.13e-22	40	183	15	156	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	6.27e-22	40	183	16	157	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DCY5|PLYD_NEOFI	5.73e-60	12	248	10	236	Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyD PE=3 SV=1
sp|Q4WGV9|PLYD_ASPFU	4.72e-59	11	248	10	237	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	4.72e-59	11	248	10	237	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|Q0CJ20|PLYG_ASPTN	1.75e-57	27	248	28	241	Probable pectate lyase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyG PE=3 SV=1
sp|Q5BA88|PLYD_EMENI	1.29e-55	27	248	43	259	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000215	0.999767	CS pos: 18-19. Pr: 0.9836

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_494771-t26_1-p1.