CAZyme Information: PHYSODRAFT_494592-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_494592-t26_1-p1
• CAZy Family: GH81
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1022		114980.86	4.9989

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:10458543-10461690(+)

Full Sequence      

MSDDISGLEAILVDEEYLNSANPGEMVLIRPPRPAPASSPGPRESRRASIDAYDARDDHF
GRDDGDDDDEDADEDEEDVPAGLQDDEDGQEDAGISDEEVEDPPPQLRPRSVPTTDARAT
SSDVHVALRSPPRSMSLGSFVVDDEDVMEMNAREQELLVNIQELQRQLSMVQIQTDKPQE
EIVPPMMDARHRLIMVSNRLPISFQRNEATGEWSFTMSSGGLVTALNGIRDQVPFIWIGW
LGEEIPHDEQSKVREKLAREFNCVPVFLSKEIAARYYNDFSNDILWPIFHYVPLPLFRPG
SEKKFDFRQWDAYKLANKRFAQAVNQVYREGDFVWVHDYHLMMLPSLLRSRHPHCKIGWF
LHTPFPTAEMYRMLPVGREILEGLLGADLLGFHTYDYARHFIAACARVPGASTSPKGIEL
GDHFSAIGVFPIGIDPEHFEDILNSDVTQKRIQELTAKFAGCKVIIGVDRMDYIKGIPHK
LLAMERFLSLYPERCKDVVLIQIGVPSRTGVQEYQHLAASVNEMVGRINGRFGTLTHSPV
HYIHRSVAPSELVALYNLADVCLVTSIRDGMNLVSHEYVMCQSQSCEPHREGPGVLILSE
FAGSAQSLSGAIRVNPWNTTDMANALGYALELPLMEREYRQTNLYRYVKTHTASFWGRSF
LTDLEDAVSRPRAVVKKLVRLPTIEVLGAYARSRHRLLVLDYEGTLFDDPTPAGAPAQQR
SNVAPPKPFVKRLVETLANDPKNTVVLVSAHERNVIGSWLTDRRVGVVAESGYFYRLPND
DEWQVMTEDTDPSWKKVVRPIMQYFTERTPGSRIDSKESSLTWHYGETDPIFGPMQARDM
QVNLEDVLCNLPLEVVQGTNRVEVRLQGVTKTLLLDEILSQFQPDNEPSSPGSRGPRREG
FSPRQSRRQRPPAPQLDFVFYAGNGVEDDELFLYFKEHMEQARKEESALQPTASATTTIA
DNSSLPPPPLPVPSGISSESSSALSKRANVFTCHIGGSKTEAMFHLERPSDLARMLRGMT
LS

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	187	665	7.7e-194	0.9789473684210527

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274112	trehalose_OtsA	0.0	192	666	1	456	alpha,alpha-trehalose-phosphate synthase [UDP-forming]. This enzyme catalyzes the key, penultimate step in biosynthesis of trehalose, a compatible solute made as an osmoprotectant in some species in all three domains of life. The gene symbol OtsA stands for osmotically regulated trehalose synthesis A. Trehalose helps protect against both osmotic and thermal stresses, and is made from two glucose subunits. This model excludes glucosylglycerol-phosphate synthase, an enzyme of an analogous osmoprotectant system in many cyanobacterial strains. This model does not identify archaeal examples, as they are more divergent than glucosylglycerol-phosphate synthase. Sequences that score in the gray zone between the trusted and noise cutoffs include a number of yeast multidomain proteins in which the N-terminal domain may be functionally equivalent to this family. The gray zone also includes the OtsA of Cornyebacterium glutamicum (and related species), shown to be responsible for synthesis of only trace amounts of trehalose while the majority is synthesized by the TreYZ pathway; the significance of OtsA in this species is unclear (see Wolf, et al., ). [Cellular processes, Adaptations to atypical conditions]
177855	PLN02205	0.0	170	1019	37	844	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
395781	Glyco_transf_20	0.0	192	666	2	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	0.0	187	670	11	483	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
340820	GT20_TPS	0.0	192	665	1	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA16456.1|GT20	0.0	144	1019	121	966
UIZ21560.1|GT20	0.0	5	667	1	655
CCA20339.1|GT20	0.0	106	1019	8	927
QOX06485.1|GT20	1.83e-243	192	939	76	781
AJA04606.1|GT20	3.72e-241	192	940	129	839

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HUV_A	8.77e-174	192	664	5	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	4.90e-173	192	664	5	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HVM_A	1.37e-171	192	664	13	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	2.73e-171	192	664	1	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	6.67e-167	191	664	11	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	1.96e-224	192	884	17	679	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q9SYM4|TPS1_ARATH	2.38e-194	190	891	91	787	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Arabidopsis thaliana OX=3702 GN=TPS1 PE=1 SV=1
sp|P40387|TPS1_SCHPO	8.17e-182	192	665	20	482	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps1 PE=1 SV=2
sp|Q9FZ57|TPS2_ARATH	1.94e-180	190	936	11	723	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Arabidopsis thaliana OX=3702 GN=TPS2 PE=3 SV=1
sp|Q00764|TPS1_YEAST	3.77e-177	193	669	18	485	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000054	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_494592-t26_1-p1.