CAZyme Information: PHYSODRAFT_491442-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_491442-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
547	JH159153|CGC18	61778.58	6.8914

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:1991327-1993100(-)

Full Sequence      

MPAPETWGARIRDSRFLGNVYIRGFGAFMLFCSVCSLSQQYSFVNDGGLGERSNIRSVAK
HEAMVLAALNAASTPDVDAAEVWTPSDTSASPTPTETSAPTPEPTPEPTPAPTPAPTEKP
TEKPTEKPTEKPTEKPTEKPKELPKRISEPRQAVKKDSKGILMCLHDGILELGISLIREL
RCLGNNEPIEVHHCHDLTKPSVDLLFGLDDNIQVIDICERYVIKKVFSDEMAKSFQSYWI
KPLAVHFTSFEELIFLDADAILLKDPAALRENEGYKEKGTLFFYDRVINNNQYLNKRENG
KGAIYLHKWLKSFDYKRFGLEYAEPSPEFKKSFAYRGRTAHEQDSSMLLINKRNAGKAMN
VLWYLITEHRFIYEFSWGDKEAFWLSFEFSHTPYFFSPWGASVVSATANKDMERHPETLC
GSLAHFDPANTSAPAELLYVNGRSLVDPVPFRLHKLNLLQPNLVFNMLPTHVTPRQERRA
PAGKGEWPECMTGMGSTPAPPQLLLNLWRRRLHFQAISMGFIEPLLQCDNPGDRLPDIPE
PVAKAKK

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_491442-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	159	427	5e-49	0.9924242424242424

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	4.96e-32	158	427	1	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
282710	PT	1.98e-04	119	145	9	35	PT repeat. This short repeat is composed on the tetrapeptide XPTX. This repeat is found in a variety of proteins, however it is not clear if these repeats are homologous to each other. The alignment represents nine copies of this repeat.
236940	PRK11633	0.001	67	153	75	144	cell division protein DedD; Provisional
282710	PT	0.001	120	142	14	36	PT repeat. This short repeat is composed on the tetrapeptide XPTX. This repeat is found in a variety of proteins, however it is not clear if these repeats are homologous to each other. The alignment represents nine copies of this repeat.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA22801.1|GT71	1.26e-115	151	528	51	430
CCA15193.1|GT71	8.93e-114	158	529	131	516
BAP68847.1|GT71	7.40e-90	158	441	65	355
AIG56246.1|GT71	4.40e-65	158	498	64	434
AIG56397.1|GT71	2.75e-63	157	513	90	453

PDB Hits     

PHYSODRAFT_491442-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P53745|MNT4_YEAST	9.64e-18	153	442	192	482	Probable alpha-1,3-mannosyltransferase MNT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT4 PE=3 SV=1
sp|Q59YS7|MNN14_CANAL	3.06e-14	157	386	274	499	Putative alpha-1,3-mannosyltransferase MNN14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN14 PE=2 SV=1
sp|P53059|MNT2_YEAST	2.37e-13	158	442	174	460	Alpha-1,3-mannosyltransferase MNT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNT2 PE=1 SV=1
sp|Q59VL7|MNN15_CANAL	2.86e-12	150	441	254	575	Putative alpha-1,3-mannosyltransferase MNN15 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN15 PE=2 SV=2
sp|Q5AGA9|MNN13_CANAL	2.00e-11	157	387	330	576	Putative alpha-1,3-mannosyltransferase MNN13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN13 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.900448	0.099559

TMHMM  Annotations     

Start	End
20	42