CAZyme Information: PHYSODRAFT_491398-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_491398-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420		44467.80	9.6686

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:8635342-8636604(-)

Full Sequence      

MQILRLVIVAVAAFAVQGTQAGSSQYSVEQQSPKQSSTSKGSSISTGSAPGLAAGTTGGG
NVAPVYPASLDDLRNYLKDSQPRVIVLTKTFDFRGSEGTRTETGCRPKSNRDCLAKNNGY
KGQDVILQSGGMANTGGCVEGTQVKITYDLAASKNPLVVSSNKTLRGLGTSGVIKGKGLW
LNGNNIIIQNIHITQLNPHLIWGGDAIYIQGLNGGKTPMERIWLDHVKISNLGRQMVATG
TASVKSMTISNSEFDGRTQYSATCDGNHYWTFLFLGTQTQVTLVNNYVHNTSGRSPKVGG
NSIVHAVNNYWSNNTGFSYDVVDNGNVLLEGNYFENTAIPNKHDAETVGAIIVPSSNSQS
SCKSALGRSCVENALSKCGSLTGNRESAALSNSKKVASYYKPTSAKKFGSTSQNFGVGPI

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	146	336	6.7e-80	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	3.53e-25	144	337	2	189	Amb_all domain.
226384	PelB	1.77e-10	119	336	51	275	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.52e-09	153	334	26	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19249.1|PL1_4	6.97e-228	1	420	1	432
AHX74067.1|PL1_4	6.97e-228	1	420	1	432
ACR19252.1|PL1_4	1.55e-224	1	420	1	432
ACR19255.1|PL1_4	2.92e-219	1	420	1	398
ACR19247.1|PL1_4|4.2.2.10	4.81e-218	1	420	1	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	3.68e-69	47	418	5	358	Pectin Lyase B [Aspergillus niger]
1IDK_A	1.61e-63	46	382	4	322	Pectin Lyase A [Aspergillus niger]
1IDJ_A	5.29e-61	46	373	4	313	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	1.09e-80	51	382	29	342	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	2.57e-77	46	420	25	383	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	2.57e-77	46	420	25	383	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|B8N316|PELF_ASPFN	4.30e-76	51	420	29	382	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	4.30e-76	51	420	29	382	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000228	0.999743	CS pos: 21-22. Pr: 0.9744

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_491398-t26_1-p1.