CAZyme Information: PHYSODRAFT_489146-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_489146-t26_1-p1
• CAZy Family: GH72
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350		37429.72	4.6640

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:8306019-8307320(-)

Full Sequence      

TSGGSVPDGTWPTSAGTVQFAEARIVKAGEVFDGKMKTYERSDVSCEGQTESGADTAVFK
MEPGSTLKNVIIGKNQMEGVHCDKHDCTIENVWWDDVCEDALSVKGGTASSVTTVTGGGA
RSADDKVIQHNGFGTVKIDGFYGEDISKLYRSCGTCGDKQRKVDVSNVYIVNPDNAVVTV
NKNWKDEATLSNIWVKSSGKKVKICQWSQGNADGEPSMLGDGPSPPLCQYSESDIHLNQD
VQTASKSTDENNGGGDEEQKTSSKSSNGDNKEESKDNSSKSSKGDDKSEKKESGSKQEQE
VSSDESVMQSEIGGEADPTAVKSDAATKESMYTSTATTSTSKCNIRRRRN

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	15	210	7.5e-79	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	3.04e-88	9	214	2	199	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADN18841.1|PL3_2	2.74e-158	1	252	16	267
ADN18837.1|PL3_2	6.53e-112	5	235	30	258
ADN18840.1|PL3_2	1.15e-107	6	235	31	258
ADN18839.1|PL3_2	1.31e-92	3	243	20	281
AHX74070.1|PL3_2	1.31e-92	3	243	20	281

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	8.54e-26	26	154	11	135	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	2.92e-21	14	154	4	138	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	2.99e-21	14	154	5	139	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
3B90_A	4.15e-21	38	235	8	223	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4Z03_A	2.50e-20	14	154	13	147	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CJ20|PLYG_ASPTN	5.05e-60	12	232	28	241	Probable pectate lyase G OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyG PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	1.36e-58	12	232	23	237	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|Q4WGV9|PLYD_ASPFU	1.36e-58	12	232	23	237	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1
sp|A1DCY5|PLYD_NEOFI	7.41e-58	12	232	22	236	Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyD PE=3 SV=1
sp|Q5ATC7|PLYH_EMENI	5.76e-56	12	232	41	255	Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000028	0.000006

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_489146-t26_1-p1.