CAZyme Information: PHYSODRAFT_488392-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_488392-t26_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
815		88042.93	4.0374

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159153:5365295-5367847(+)

Full Sequence      

MRGLQVAAVVVAACSTNILVEASTDYGVFTPKKLALGSAPTIASTDYTKGFTLTAADPIA
TLDYDYEVAGLPYFVVSAVSNGPVDVEVKYSEQFAVLSTNFSDGPSQFATAVANSRRVET
HRFTQEEIGATVTSMLSQPGQRWQTLRLLSGDSVTFEAVGLQASIEVIDDLATLPGKFSS
SNAKYNEIWNLGARAVSAACLDAGSQISSWSASEENGTFVPGTRPGVSYKTWNLSDYTLE
FETQIIRGGVGFYVGYDIAANRGSLMFHLSSEYPANSTYVNTNMTLFPANSVTLTYGFDF
VNTTDMKSYPMGNYEVPFNVKEYVWYPLTLNDYSTTGKGAIGFGGWQDQASFVRNVTATS
LNDSTNVLYSNPMTDESVVLPEFGVQSNTYGVCLDGAKRDRYIWLGDFYHTTRIIGVANS
KPEQITGTWEYLLDYQGSNGQYPGLMVMTYETPMPTPEVFMFNAGTADAYLNFPDYDILG
LIGFVSYMEYFNDVDFARANWESLRNATAWLASCQESNGLIDVNKYVDVYVFLGSSAGTA
VNAAAVQCLEGMAKVAEAVGDEGSANEWAAVAVTVKTAINELLWSDALGNYAVDVSTPEV
YGVSATAFAITSGVASETQIKLCVESLEGLRQGPGYLDSSTTDNTTKISPNTNGFLLDAL
LQTGHTDEAVFLLDNLWDAMISNESYRSGASWEYVSQSLEPGLQEFTSLSHPWGGAPTYA
LTNYIAGIRPVDFGFRRWIVNPLVTGLGLTNANASVSTPYGSVAAAWTRDDTQLNVTITA
PVGTEGTFEVVLLNSSSYTQSLNGTGEAISFTVQL

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_488392-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	355	788	1e-67	0.7976190476190477

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	2.56e-11	727	792	1	63	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	1.50e-10	432	725	72	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD52401.1|GH78	3.82e-189	31	803	27	830
ATZ56607.1|GH78	1.58e-188	23	803	43	854
QMW40986.1|GH78	7.17e-176	29	788	26	806
QMW28911.1|GH78	7.17e-176	29	788	26	806
QRD85156.1|GH78	7.17e-176	29	788	26	806

PDB Hits     

PHYSODRAFT_488392-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T2KNB2|PLH20_FORAG	5.61e-06	338	797	462	885	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000802	0.999168	CS pos: 22-23. Pr: 0.7516

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_488392-t26_1-p1.