CAZyme Information: PHYSODRAFT_487824-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_487824-t26_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464	JH159152|CGC15	52238.65	5.0602

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159152:1253712-1255283(+)

Full Sequence      

MLRLVTFTALLLALARDAKSQVEGEGEASESTVEWDNWAKSAKLNPTVQHIPLDPSESDL
RPPPAQIPDSFDMFVGSSVFRDGYRCGKTLFTALKRATHPERLQFGILEQIYEGDPTCLD
EYCKMAAEEWPEDQECRYKAQITVDTRDAAESAGCTTARHLQQKLVGDQEFCLQVDGHSV
FTNRWDENILADWASIDNEMAVMTMYPHHTHTYMINEEGDNTITNSIPHLCTTIRGGNGL
PRIVGASLIKDSWKPQMAALWGGGYSFSKCHAERRVLIDSHTPWLWDGEEFMRSANYWTY
GYDLYSPSRLGNVLYHNYSKKPESVWAAPIDPEKKERDTEMAENRVRLRLGIPFKGPVDT
FELEKYGFGTVRSFESFLEFANVSLEGWMNDTNSCGQLHWVPYEDPTEVEETVGVAKSSG
MSSSTFVGVVVVAAVFVTISTDAGSRAIRRRVCGTMHGRTHRSI

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_487824-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT60	73	385	3.3e-57	0.990909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371506	GlcNAc	5.01e-40	72	386	1	350	Glycosyltransferase (GlcNAc). GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1, a ubiquitous eukaryotic protein, in the cytoplasm.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ25379.1|GT60	1.24e-237	1	414	1	414
UIZ22573.1|GT60	2.85e-164	10	414	9	412
QVE55543.1|GT60	7.41e-151	30	414	26	408
UIZ25301.1|GT60	4.31e-148	40	414	17	392
UIZ22347.1|GT60	3.27e-46	56	403	42	385

PDB Hits     

PHYSODRAFT_487824-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T1C6|GNT1_DICDI	8.01e-12	73	326	6	257	[Skp1-protein]-hydroxyproline N-acetylglucosaminyltransferase OS=Dictyostelium discoideum OX=44689 GN=gnt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000211	0.999765	CS pos: 20-21. Pr: 0.9654

TMHMM  Annotations     

Start	End
426	448