CAZyme Information: PHYSODRAFT_486818-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_486818-t26_1-p1
• CAZy Family: GH7
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		40260.28	4.8675

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159152:8142828-8143904(+)

Full Sequence      

MALSAVGVLFTTSQVGSFVQVNQDQTATSATTAAGKASRLHFRSAEEGALQTEANATTNA
NASLELSEAATGIPRIIHQSWKTTDKIPTRFFPWMRSWLQFNPTWAYTFWTDEDNLQLFE
RLYPKYLDVAKNVQMVALADMARYALLHSVGGLYIDADFECLKPFEELHRDNNLFLSTEP
LAHSVLLEGATSSALCNALMASVPGHPFWLQVLDNIKVKFAEGVRDPVSLTGPRIVKETY
LTATPEAAEVIVYPPEYFYPDIAHWNSEPFDTACRNRDDEAAKEACEWMKKFPNGEYTDN
THAVHHWQCTWCRDAQLTEYGSLDDIFSSPVMRPNISSTGVTLTPYIPANSAHFWPFW

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_486818-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	95	170	5e-17	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	4.04e-20	73	238	82	238	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.02e-09	96	168	9	86	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
368570	Caps_synth	0.001	96	222	70	193	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDZ26039.1|GT32	1.06e-39	73	311	14	288
UPR05240.1|GT32	5.68e-39	73	311	14	288
ADI10024.1|GT2|GT32|GT62	3.30e-35	72	314	6	227
QKV94833.1|GT2|GT32|GT62	5.05e-34	71	334	5	250
AQW50986.1|GT2|GT32|GT62	5.12e-34	72	314	6	227

PDB Hits     

PHYSODRAFT_486818-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P38287|CSH1_YEAST	8.20e-16	73	217	62	194	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	1.75e-15	67	216	51	188	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	2.93e-13	73	216	64	199	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2
sp|Q9UT67|IMT2_SCHPO	1.58e-12	73	217	82	214	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q5UQW4|YL373_MIMIV	2.46e-08	73	260	2	185	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.749073	0.250927

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_486818-t26_1-p1.