CAZyme Information: PHYSODRAFT_481772-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_481772-t26_1-p1
• CAZy Family: GH54
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1494		168354.85	5.0281

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159152:10375167-10379870(-)

Full Sequence      

MLATRTYSVKVEMFRQLALDSGLVACSVDELEAVLKGKKQQANEQSCVAAGVNDVELQVD
HKYPNSVSDVEEKPLSAILYGLVGTEKFHAFHSKLVKQAQKNKIQYMVRHYPRDSPLDTL
LQGYGVALDIKNMEYKTIDDSKKTGEEEAAADEENGDEEDEEEDEIDDEEVEGFLFNHLM
ARHGAISGELKQFYDILVKKADGEQEQELKAWHLKDLGASAVRAIVDAKNPLKRLETLSQ
DFPVQAKKLAFSRKSISAELRDEMSATRMQAANRRLKNKFILNGIAVDPLERSFNVFDFM
KTLKEEWSVAKQLGGLPMNQSELEEMLAHVRQTNQEQPAVRIHMRGSMGGSTPLYLNNIE
TDPNSASWSSDVDTLRRPAWNLIFVRKNMYECVLVLDPLSGTGRVALSHIGFLRMRGAPV
QWALLVSSKELMASKTADDRRALLEMYKSFKEADKATPWHFAKLLMLSQSKDAAEAEALQ
KESKGSRSGDEETSETEEPEDRIIPTRIASEFLQRVGEDGSSDVAVGSLIEAYTDAAGAI
GTLEENGEEAWACLKSDRFDDEILAMTEFIHLKHVPLGSFVFNGVLQKNLDIQRSMMSNF
GRDQPLYVNMAHRGLLNDDMDLVEELLDSQDAYPAYLSIFEKSEGAHPGDIEVDLPKHLF
ADDVDGRLEAAVQRAISYLHAPDSRAVPKKETVIFPADLNDPRDAGHAYRIVKAVLEDSE
QSLRVGIVPQLNSNSAEKQGSNEHLLKFVLEALNCVVKQKSVDATKDKLIGIWGKLSKEE
DSEDSVSKKISALLSSKSGKWLTPKQRNALTQCNALLRSRFPPVLAEESEEESSKMVLPH
LFINGRRVTLPPHSLSDEDVDTIVSFDLTYRTQPVAKALIKRSATLSVKKADSLSFDIMK
TTGIVDKYVRTDRAPRMEVGENSLNTVRLEGDPSLQVAAYVDPLSEAAQVMSSMLRMLHS
QLNATIELVLTPADEYTEFPLQRFYRYLFDKKPSLAATNVEFRKLPVHPILTMKIETPEA
WNVQTLHAGDDLDNLRVDPDSPTDVKSTTSAVFRLESLLVYGQCRDTTFNMYSPPNGLQL
VLEREVGAQLLHRDTLVMKNLGYFQLQATPGVWSLHLARGRAAEIFDIIDPDTDVPLETH
PVVVYDFGSHISQLFVHDGALRSYWNSMLNAMGKREDKPEKKTQDAETEGGHADSTGDDN
AVAHQKVRTGETIHVFSVASGYLYERFVKIMMSSVLKRTNNPVTFWLLENFLSPDFKKSI
PALREQFGMDIRLVTYKWPNWLRQQTEKQRIIWGYKILFLDVLFPLGVQKIIYVDADQVV
RADLKELWELDMEGKPYGYTPFCDSRNVGFQFWRQGYWKDHLRGKPYHISALYVVDLALF
RQTAAGDMLRAVYSQLSADPNSLANLDQDLPNYAQHQIPIFSLPQEWLWCESWCSDETKG
AAKTIDLCNNPKHKEPKLDMAKRVIAGELFNESWIELDQEIKDAEAQYTVEAAA

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1213	1458	5.8e-122	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1213	1483	1	267	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	1.06e-161	1213	1458	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	2.43e-59	1213	1453	1	243	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408201	Thioredoxin_14	1.02e-22	349	634	9	242	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	6.13e-21	1062	1128	2	64	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20865.1|GT24	0.0	1	1494	105	1666
CCA14500.1|GT24	0.0	2	1488	152	1665
AIG56125.1|GT24	0.0	2	1488	107	1505
AIG55512.1|GT24	0.0	2	1491	105	1518
CAB4116261.1|GT24	6.19e-192	77	1494	201	1565

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NV4_A	3.24e-141	57	1483	150	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5MU1_A	4.46e-141	57	1483	150	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	6.13e-141	57	1483	150	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	7.08e-138	841	1483	550	1212	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5H18_A	6.96e-116	1213	1494	5	280	Crystal structure of catalytic domain of UGGT (UDP-glucose-bound form) from Thermomyces dupontii [Thermomyces dupontii],5Y7F_A Crystal structure of catalytic domain of UGGT (UDP-bound form) from Thermomyces dupontii [Thermomyces dupontii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0WL80|UGGG_ARATH	8.96e-186	77	1482	195	1566	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q6P5E4|UGGG1_MOUSE	4.92e-184	2	1488	122	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	3.87e-182	2	1491	122	1530	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9JLA3|UGGG1_RAT	1.85e-180	2	1488	122	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q9NYU1|UGGG2_HUMAN	1.73e-175	5	1482	113	1496	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_481772-t26_1-p1.