CAZyme Information: PHYSODRAFT_481159-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_481159-t26_1-p1
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
284	JH159152|CGC9	30429.72	4.4106

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159152:6453512-6454366(-)

Full Sequence      

MVWKSIVLSVFLALAFPTTEAVTYSSGCGNAASITSGTYTTTVNGTEREYIVRVPEGYNS
SEPYPFIIAYHWYGGSAYNVTQDSSKYGNGSYYGLLSYANESAIFVAPEGLEVGWWNTND
DDMKFTDAIVQTIDDELCVDQDQRFVVGFSFGGSMANAIAKSGRGTTFKAAAVLSGTDYV
AAIGEPAPIGFFVGHGVSDPGNLISKGRSMRDVFLEVNGCTNQTAPEPAVGSGSHVKTSY
ANCTKPVTFIAFDGVHEYSPVDKGSSSSWVPSELWSFFFPSKSS

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_481159-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	44	181	3.9e-20	0.6035242290748899

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226040	LpqC	1.20e-13	43	278	42	304	Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport and catabolism].
224423	DAP2	1.39e-04	8	176	354	505	Dipeptidyl aminopeptidase/acylaminoacyl peptidase [Amino acid transport and metabolism].
226584	COG4099	1.80e-04	45	200	171	327	Predicted peptidase [General function prediction only].
223489	DLH	0.002	50	201	17	171	Dienelactone hydrolase [Secondary metabolites biosynthesis, transport and catabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXF48684.1|CBM1|CE0	6.89e-72	25	278	90	337
CAC85738.1|CBM1|CE0	8.73e-71	27	278	96	341
UDD56959.1|CE0	1.71e-70	21	278	20	272
SDT14961.1|CBM2|CE0	7.81e-69	19	278	40	293
UKZ53227.1|CBM1|CE0	4.68e-68	12	278	10	269

PDB Hits     

PHYSODRAFT_481159-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B2G3|FAEC_EMENI	2.28e-61	4	278	3	267	Feruloyl esterase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=faeC PE=1 SV=1
sp|Q0CDX2|FAEC_ASPTN	3.63e-60	19	278	18	267	Probable feruloyl esterase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=faeC PE=3 SV=1
sp|B8N7Z6|FAEC_ASPFN	2.06e-56	4	278	3	267	Probable feruloyl esterase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=faeC PE=3 SV=1
sp|A2QYU7|FAEC_ASPNC	4.11e-56	4	278	3	267	Probable feruloyl esterase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=faeC PE=3 SV=1
sp|Q2UI81|FAEC_ASPOR	1.64e-55	4	278	3	267	Probable feruloyl esterase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=faeC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000237	0.999744	CS pos: 21-22. Pr: 0.9769

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_481159-t26_1-p1.