CAZyme Information: PHYSODRAFT_478968-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_478968-t26_1-p1
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629		70023.74	5.2057

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159152:8652823-8654760(+)

Full Sequence      

MVSHKSPGFSLFLLLLLWSAASSLTPGRRFIRPSPELMDSPVETASHAVDNPRHQEIKQL
QRVYCRGELLHEVQTQELFPDSKHFVDMPIKASSSVEQVLTQFQELEANFSNDNTTGAAA
DWKARLAVFVDQHFDSPGAELVPTTPPDFHEGEVPVRIMEIRNESLRGWAMELHKLWKVL
ARVPASAASGEASRSSFLHSLPIAAAPGDPQSALARQFHGENVLVVPGGRFRESYYWDSY
WIVQGLLVSGLRQTARGVVNHLLEYVAEFGFVPNGGRIYYLTRSQPPMLSDMVRVVAKLE
NSSSDEDADAWDLEYLRAAVPLLEREYDFWMHRGVHGHAVEIPGPHGETFVLNRYVAHAG
EPRPESYREDAAVYNEIIAAAESGWDFSSRWFADYSTLKTIRTSRVVPVELNSILHRVEL
NLAKFYEVLGNSVASLRFRDAANTRTRAMDAVLWSESEGCWKDYLLDSREHSRVVSIANY
SPLWGRAFDASDSARLEKIVTSLEKSGLVQEGGVQTTTSVTGQQWDAPNAWPPLQDIIIE
GLQAADTPTALTLARGLVQTWVEAGFVAWQKTGLMFEKYNAQQLGGVGDGGEYTPQFGFG
WSNGVILSFLTKYQDQLGDAAEVARLVGA

Enzyme Prediction     

EC	3.2.1.28:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	78	613	2.1e-150	0.9979633401221996

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215307	PLN02567	0.0	63	613	12	544	alpha,alpha-trehalase
395961	Trehalase	1.08e-154	77	613	1	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	7.17e-99	60	618	52	557	Neutral trehalase [Carbohydrate transport and metabolism].
237326	treA	1.15e-84	67	610	49	533	alpha,alpha-trehalase TreA.
183936	treA	4.92e-84	68	613	51	536	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20373.1|GH37	1.25e-312	31	604	3	595
AOW41677.1|GH37	1.36e-225	21	617	6	613
UIZ20368.1|GH37	4.60e-203	56	617	170	746
CCA17719.1|GH37	1.59e-198	59	619	123	707
CCA18365.1|GH37	1.59e-198	59	619	123	707

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	4.92e-111	80	613	39	554	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	7.59e-110	80	613	39	554	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
5Z66_A	2.06e-76	67	612	52	538	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JG0_A	6.03e-74	67	610	15	499	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	1.85e-69	67	610	15	499	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9JLT2|TREA_MOUSE	4.67e-129	62	626	28	560	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|O43280|TREA_HUMAN	2.82e-126	63	626	32	563	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|P19813|TREA_RABIT	2.13e-124	62	626	31	562	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|Q8MMG9|TREA_PIMHY	6.13e-119	63	619	49	577	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1
sp|A8J4S9|TREA_APIME	5.23e-115	63	617	45	572	Trehalase OS=Apis mellifera OX=7460 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000262	0.999721	CS pos: 23-24. Pr: 0.9212

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_478968-t26_1-p1.