CAZyme Information: PHYSODRAFT_478479-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_478479-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: ricin B lectin-like protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
436		49425.40	5.0169

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159152:1912382-1913692(+)

Full Sequence      

MKLYLPTLVAAVIATLYAGVDAVPKGVSGINYDARNGSDWETNNASCKSFTDVYHEMLTL
QTFTEKVRTNSLIECDVANLVLQFASSIGVTVDLGIKTSKGRDYFLQEKVKLGEIIDKGR
FDTVTSVHVGNGAISRDNVTVDTALEYMTEIRDFLRSRGKNASVTIADSIEVYNTNPKLL
EAVDYVSVGYSPFWERVDVNEGVAVTLDRMKSLRIAAENKDKPVVIDTAWSSGGMNPIPD
LATPKNQAKYFSDFIRMAHSHKDLDYYWSDAFDAKWLNDLDIEAHLGVYEKAGVMKEEIF
NLQFENWRAPRLIRTEGSIMLSEADGKLYMSEKSNNWLTQEQQTWFFDETTQQIRSKSSD
RCLDAYQPWDGGAVHVYRCMDNERNQKWTYDNATRTLRHATHKGFCLDQDASQNNKIQLY
GCSPNNAHQQWEVLDP

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	336	434	1e-15	0.526595744680851

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	6.55e-28	2	290	5	302	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	1.82e-20	339	431	34	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	4.26e-15	353	433	4	84	Ricin-type beta-trefoil lectin domain.
238092	RICIN	2.45e-13	353	433	2	82	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	2.81e-13	354	433	1	76	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBC18032.1|CBM13|GH17	1.42e-147	1	410	1	414
QBC18038.1|CBM13|GH17	1.42e-147	1	410	1	414
QBC18040.1|CBM13|GH17	1.42e-147	1	410	1	414
QBC18039.1|CBM13|GH17	1.42e-147	1	410	1	414
QBC18034.1|CBM13|GH17	1.42e-147	1	410	1	414

PDB Hits     

PHYSODRAFT_478479-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

PHYSODRAFT_478479-t26_1-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000191	0.999761	CS pos: 22-23. Pr: 0.9819

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_478479-t26_1-p1.