CAZyme Information: PHYSODRAFT_475487-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_475487-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
563	JH159151|CGC26	62246.12	5.6491

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:201304-202995(+)

Full Sequence      

MRAAQLTAATAALLALHLGSSAADLVTYDWRVTNLNVEYDGVFIHSLGINDKPADQAVID
VELGQDVEVRVTNELDEPTCLHWHGLKQLGTQEMDGTSEITQCHISPNSTAVYRFTPDKA
GTFWWHSHHMAQYAYGLRGPLVVHAPANERQDWEKDIDGEFVIHMADLYHRPPQPTRMWD
NILINNRGRYNCIAAAHHNFTGCTEEQTLSKFNFVPGNKYLLRLINMAALSPIVFSIDDH
EFQVVAADGDHLQPSKFINSVTLNAGQRYDIVVQAKAAAGQNQKTAFWMRANGLHGLPWT
RGTAAIAGEGYTYEGLAIISYGSESEAEPTTTKQANLTTVNEFDFMPLVPIALPETASDR
AVFEFKMQDGKGHFAIDGGEYHHFMYPEEPPLFSIAAGMKTEQLPVEANARKIEFGKHIE
VVLVNVKDEQHPFHMHTHSPWVVGSGVASIDQIRKNQLPAPLKLLNPMTRDVYTVPPCTS
DGNGGCLDAGYLVLRFNADNPGVWIFHCHIDWHLEAGLSMILVEGEEELQTKGVSAFSNT
ILSVCGANSKFHPGNNGTSIAVN

Enzyme Prediction     

EC	1.10.3.2:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	57	518	2.4e-89	0.9385474860335196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	2.54e-66	28	527	4	526	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
225043	SufI	1.46e-57	58	527	65	451	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].
215324	PLN02604	8.45e-57	59	527	57	549	oxidoreductase
177843	PLN02191	9.36e-57	20	525	18	547	L-ascorbate oxidase
274556	laccase	2.11e-49	59	531	36	528	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFY09916.1|AA1	0.0	7	555	7	554
UIZ26488.1|AA1	3.23e-300	13	551	4	542
AFY09915.1|AA1	3.84e-192	10	548	6	568
UIZ26495.1|AA1	1.15e-185	25	551	23	567
AIG55536.1|AA1	2.52e-87	26	547	41	555

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HFU_A	6.74e-63	32	524	11	468	Chain A, LACCASE 1 [Coprinopsis cinerea]
1A65_A	6.89e-63	32	524	11	468	Chain A, Laccase [Coprinopsis cinerea]
5Z1X_A	4.13e-62	64	525	41	466	Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z1X_B Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z22_A Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena]
1V10_A	1.99e-61	21	524	19	489	Chain A, Laccase [Rigidoporus microporus]
3SQR_A	3.45e-60	28	532	70	550	Crystal structure of laccase from Botrytis aclada at 1.67 A resolution [Botrytis aclada],4X4K_A Structure of laccase from Botrytis aclada with full copper content [Botrytis aclada]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12570|LAC1_BOTFU	3.23e-62	32	540	69	541	Laccase-1 OS=Botryotinia fuckeliana OX=40559 GN=lcc1 PE=2 SV=3
sp|E9R598|FETC_ASPFU	4.33e-61	18	530	16	498	Iron transport multicopper oxidase fetC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=fetC PE=2 SV=1
sp|A0A067XMP2|PTAK_PESFW	7.26e-59	27	529	66	553	Oxydoreductase ptaK OS=Pestalotiopsis fici (strain W106-1 / CGMCC3.15140) OX=1229662 GN=ptaK PE=2 SV=2
sp|Q09920|FIO1_SCHPO	1.96e-58	28	527	27	500	Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fio1 PE=3 SV=1
sp|Q01679|LAC1_PHLRA	1.04e-56	29	524	28	490	Laccase OS=Phlebia radiata OX=5308 GN=LAC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000249	0.999740	CS pos: 23-24. Pr: 0.7214

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_475487-t26_1-p1.