CAZyme Information: PHYSODRAFT_475131-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_475131-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: beta glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
680	JH159151|CGC6	73817.55	4.4922

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:5176838-5186596(-)

Full Sequence      

SELATKRASKHKRPTKLSMLKKWLLAVCCAAVGFTAATSDDLDTRASSIVDNFTPEQIVG
QLAQVAIFSVLNEDYSLNEELVRYYAKLHVGSFLTTPFTNGPNAITGAVGWDVAQWRDII
TRIQEIVLEENDGIPMIYGIDSVHGAGFILNTTLFGAQINGAASFNPDLVYEMGRVTGQD
TQAAGIPWVFGPILEIASNPLWPRTYETFGEDPHLVSVMADAVIRGLQSNNQTAACMKHF
VGYSKTPTGHDKDAVQISDFDLLNYFVPPFKAAIDAGVMTTMENYISINGVPTIGNHKIL
QQLLREDLAFEGLAVTDFGEMGSLNSFHRIARTVDEAVRMSYVHTGIDMSMGVADVYLNS
TKLLLGESPEYFDRLKVSAKRIIKTKLKLGLFDTPVPGADDIAKVRNEVDVEKSLEMARE
SIVLLQNNDSTLPISSSASVFLTGHSANNIGNQCGGWSVSWPGYTGNDLFPNGISVKEGM
EAIAGDKVTYFNGLDSDGNYSEANMTTAKQYASQAEYTIAVIGEHPYAEKTGDLDDLALP
AGQIEYVNELASTGTKVIVVLFEGRPRLLGDLPENVHAVVNGLLACEQGGKAMAEIIYGQ
VNPSGRMPITYPKDAGNILIPVYKPQIGEGFKQVAEDTDYVIAIKPETDCDVYNETAAAN
PLCATFTLQTGDYPYGFLLS

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	130	351	1.2e-62	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	5.13e-80	133	623	103	609	beta-glucosidase BglX.
224389	BglX	1.19e-73	54	459	2	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	6.58e-51	54	383	1	314	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	2.28e-39	422	631	1	212	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.81e-38	141	677	89	627	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	8.33e-243	19	669	1	763
CCA27737.1|GH3	1.60e-214	44	669	66	809
UIZ29613.1|GH3	7.32e-214	17	674	44	825
UIZ27116.1|GH3	1.30e-213	62	669	1	725
UIZ29432.1|GH3	1.10e-212	19	674	1	769

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	2.50e-97	38	625	9	608	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5M6G_A	1.59e-71	116	620	104	596	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
5YOT_A	6.69e-69	42	623	14	593	Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	6.69e-69	42	623	14	593	Chain A, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
6R5I_A	1.67e-64	117	630	55	584	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	3.48e-117	43	673	77	722	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	1.75e-96	38	625	31	630	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	4.23e-66	119	620	50	571	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	1.07e-64	112	630	88	616	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	9.46e-63	117	630	86	616	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.529832	0.470154

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_475131-t26_1-p1.