CAZyme Information: PHYSODRAFT_473674-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_473674-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589		64689.18	6.7804

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:10090937-10092780(+)

Full Sequence      

MLRHALRFGHGRHATVVKATATCGLTSSVTSTEFDFIIIGAGSAGCVLANRLSADPSNKV
LLVEVGPSDRNRWDSVLIEMPAAVPINLADDRYNWNYFTEPQEFLNNRRVGFPRGRVLGG
SSSVNAMLYNRGHAKDYNDWEANGAEGWSYADCLPYFKRSQNHQLGEDEYRGGDGPLHVV
RNTQKDQPLFQAFLDAGVQAGYPLTDNMNGYQQEGVGWHDLTIHKGKRCSASSAFLHPVM
DRENLTVVTDTLVNKLIFEGKNVVGIETEDNKTKAVTKILSGKEVILSGGAINTPQLLML
SGVGDADHLKEVGVPLVHHLPAVGNNMEDHVGVHLQFACKQPITLYNASKRYPGKVLKIG
YEWLTAKTGPGATPHCEVGGFIRTAPGKEQPDLQIVFSPCAVDERCQMREDIGHAMSGHI
ALLRGSNNGTLKLRSANPRDHPLIDPKYLADEDRRLTLREGVKLTREIFAQNAFHEFNGG
GISPRDSVQSDEEIDAWLRKYSGPEFHVSCTARMGVDDNSVVDPQTRVHGLEGLRIVDAS
IMPNIVSGNTNAPVIMMAEKVADMILSKPALPKADVPVYEPSKWQTSQR

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_473674-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	33	567	7.6e-162	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	0.0	27	571	1	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	0.0	30	589	2	555	choline dehydrogenase; Validated
366272	GMC_oxred_N	1.13e-53	106	330	15	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	1.53e-40	429	560	5	142	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	2.40e-32	26	566	48	577	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	5.60e-265	1	589	1	581
ANI26486.1|AA3_2	2.17e-206	2	588	37	624
AWP09430.1|AA3_2	2.31e-203	22	582	6	567
CAB3230510.1|AA3_2	2.75e-203	26	581	17	571
CEF60566.1|AA3_2	5.57e-166	36	583	35	585

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YS2_AAA	1.47e-98	27	568	1	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6YS1_AAA	2.91e-98	27	568	1	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
6ZH7_A	4.09e-98	27	568	1	563	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	4.09e-98	27	568	1	563	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	4.46e-98	26	568	16	579	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6UPE0|CHDH_RAT	1.43e-208	18	588	28	599	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8BJ64|CHDH_MOUSE	5.99e-207	27	588	36	596	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	1.83e-205	18	588	28	594	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|B6I074|BETA_ECOSE	1.86e-164	33	574	2	540	Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain SE11) OX=409438 GN=betA PE=3 SV=1
sp|A7ZI50|BETA_ECO24	1.86e-164	33	574	2	540	Oxygen-dependent choline dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) OX=331111 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000004

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_473674-t26_1-p1.