CAZyme Information: PHYSODRAFT_473590-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_473590-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
726	JH159151|CGC36	79351.60	4.1267

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:8737697-8739877(+)

Full Sequence      

MLSRWTSVVAALAVMTATSLASTTTYETKSGVRPWVDVDTPSKAQTHKSSRGETWTLVMS
DEFNVEGRSFDAGEDHLWTAIDKPDGVNAALEIYYPNMTGTACDDDGNCYFYIESDIHET
NLTVWNEYISPPGYEDVTFYYRSAMVQGWNKFCFQGGLVTVRAQLPGAVSNASGNPDVET
GSTSVRAANIDYYPTWPGIWLMGNLGRGIFTGSTARMWPFSYNECNDTIFDSQNQRISAC
DDNPGSGMNPNQGRGAPEIDILEGGGTAISSSIQVGPGMPEDFRTIVDNSSAYCMYSYDC
TTEGANNQDVPTKYYWNLRGHKTWYQGLRYAANNLCDVEKDDVQSFATINASVTKGITEN
ACTMDLCPASYDVNADLGFKDNGTVHWGVNTNGTCFPKQNAYTGAYLCNAGNTASVCTQS
GGSTSSGSEFTYQMDAISSDWEVHMAAYLDWVTYSLEWVMGDAGYIRWEVEGQVIFEIPA
DAVTNPPQDTAMMNPKKLMIEEPMYFIFNVALSSSWGSKPPNAGSSGCYGDGTDNTTNAI
CDEFPMYMKIDYIRVYQDVSDESSMAVGCDPSTHPTKQWIEDNIDDYQDDDNLVVEVSGM
AFCDSDDDCTISTTGSSAVRTGTCNADKRCECSSDSWTGPRCTTTATNEDGDNLYGPPII
VALIIAAIACVVTFCTMLYKVTQAKRNGSRMRDQALKMEHAKHVQAVGVESVDDGVKAPH
STTNHV

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	61	293	8.1e-60	0.6196319018404908

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	4.02e-60	36	581	98	470	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	1.55e-49	57	557	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	1.04e-12	450	556	159	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185691	GH16_Strep_laminarinase_like	2.98e-05	383	557	145	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185683	Glyco_hydrolase_16	2.41e-04	450	556	143	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27996.1|GH16	0.0	1	699	1	702
UIZ27810.1|GH16	2.17e-273	26	677	65	731
UIZ28151.1|GH16	8.73e-272	21	695	25	711
UIZ28149.1|GH16	1.42e-270	25	669	28	690
UIZ24235.1|GH16_2	2.93e-260	27	667	30	678

PDB Hits     

PHYSODRAFT_473590-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32486|KRE6_YEAST	2.39e-33	36	602	307	702	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P33336|SKN1_YEAST	3.87e-33	36	277	359	574	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|O13941|YEPB_SCHPO	2.60e-31	36	602	219	618	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1
sp|P87024|SKN1_CANAX	3.22e-30	36	298	336	574	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P87023|KRE6_CANAX	1.01e-29	36	602	332	732	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000273	0.999679	CS pos: 21-22. Pr: 0.9784

TMHMM  Annotations     

Start	End
659	681