CAZyme Information: PHYSODRAFT_472166-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_472166-t26_1-p1
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1134		127040.09	4.6531

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:12149214-12153011(-)

Full Sequence      

MTDGAGFKEREAALLRELSALYTKLNQVREKRVKAEQESGSGADGDVDADDDAGGRGSRR
RRRVLLVTRTLPFWLVSEDAQSQWRAEFPEHASLNGAMEIFRSLHESYDCVWIGSVHGEI
EPSEQNTLKEQLLQDRNYYPVFLDEKRERLYYQGFCKTVMWPLFHSCPPTTDDQIIQHEM
MEGGQEDERSMEKMWQAYVAANQAFADAVQEVYEEGDLIWIQGYHLTLVPQMVQNLFPND
NICLGFFMHIPFPSAELYRILNNREEILTGILGADLIGFQTYEYARHFQSACVRLLGLES
SHKGVDYNGHFARVTICPVGIDADKYIAMVQSDSVQEQMKQLESQFAGKQVILGVDQLDQ
TKGLVHKLLAVEELFTQKPELAKEVVFLQIVTGASVFESALESQVESLVSRINSKLQDIG
TEGPVQYLNKEIAVEALIALYALADALVITPVRDGMNTVPFGYIVCREATSKHARVILSE
FAGCAQSLGGARLVNPWNTEELTDALQESLRDNDEVMRAHQHMYSYVSSFTSWHWADNFL
EQLHECSEENALSVSGRELSRRDMTSAYSRSSRRLIFINYEGVLAAEASIPELAYPPQEL
IWQLSMLTKDPRNTVVLVSARSTSVCEQWFAGLSGNLVLAAEYGVYVKWVGKNEYWHCMV
PNMDMSWWEHVVPLLEYYTERTPGAYIERKESSVAWHYRDCDLDHGLWQASELLVSLREI
TRALPVSVCPGNRYLEVRPQKVSKATLFERIWEFMNWSTLFPGEDPVTTEYFGEPVHSQS
SPMMKPRGFYNNPADDEMPEFSLDDRHLSESGGDYIHAGRKDSVSFSLDAGALSSLDVLD
DKQPVDFVLVIASGDDRTDEDLFAFLVPPPIDLEAYCRQLEKDDFIQDSGDSEGGIGSSS
FGDISDDMSYNAFRRLLGRDGSLTSLAAGSPGERGGLSAAASLARLSSQPNDADFLMLGE
NMTKLTPLAKPSISDGAATMFPVAMLNRPSNARRDEITEKSKFTPRRDFPPSAALFKAMK
VKYGDNFGIHRLPDTPAACWALVCPPTARAKLEDGAGAQSGGTSQTTSVSTDEPDDGRYR
FPVNTFVCTLGRKLSQAPYFIKNSGDLFQLVQEMGMSSHIRKQRMLSMGSVGDI

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	59	544	9.3e-149	0.9768421052631578

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	102	771	35	685	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	5.31e-170	102	544	35	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
215556	PLN03064	9.22e-158	108	786	134	789	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
395781	Glyco_transf_20	7.31e-157	111	545	47	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215555	PLN03063	2.31e-151	106	751	49	686	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28038.1|GT20	0.0	1	1134	1	1245
CCA15235.1|GT20	0.0	8	1127	28	1218
AJA04606.1|GT20	5.19e-157	63	751	129	806
AGT80036.1|GT20	5.19e-157	63	751	129	806
QOX06485.1|GT20	1.17e-155	63	756	76	755

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	2.71e-97	63	558	13	489	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	9.08e-97	63	552	5	476	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	1.26e-96	63	552	5	476	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HVO_A	1.69e-92	63	547	12	478	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	2.83e-90	63	544	1	463	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	9.72e-150	63	751	17	673	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q54NU9|TPSB_DICDI	2.72e-135	77	751	62	725	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|Q9LRA7|TPS9_ARATH	4.26e-133	63	751	60	765	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|Q0WUI9|TPS8_ARATH	4.47e-133	63	751	58	760	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|O80738|TPS10_ARATH	2.05e-130	63	783	60	806	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 10 OS=Arabidopsis thaliana OX=3702 GN=TPS10 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000023	0.000002

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_472166-t26_1-p1.