CAZyme Information: PHYSODRAFT_471476-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_471476-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
727	JH159151|CGC33	80318.67	6.8674

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

Full Sequence      

MLLDVSPREASVLLVFLAALATAWTANANGFVWDDRSAVLANADAQSSGLLDVWSHDFWG
THIRSAHSHKSYRPLTVLSFRLNFLLAGGHSAWFYHCTNALVHAACSVLVWKVADELFWQ
HKRRLGEEEKVTENPQDASPMAANGREKAEHDGEGCSLVGSVTAGLLFAVHPIHCDAVAS
IVGRADLLCTSLCLLAFLVYARGAGEGDTKWGDVALALVLTVAAGLCKELGFTNFALLVV
YDLLRIHHYRSVVRGVQSMKWRIGVTVGVGILAALVRVWVNGEHRQMEWNILANNVVVQE
SRLTRTLSYAHLHAWYLWKLVWPRWLSFDYGYNTIPVIEGVADPRNVYTLLAYAVVLIGL
RSAMLQLWGSSKTSPSSLLMMSIAFGVVPFIPASNIIFPVGTVVAERLLYFPSVGFCLLV
GHLRNADWVSEESLFKEAVKVLPTNVKVLSNEAKNLLNPDPAKALDYLRVAMGMIPKHIE
SQTNAGLAFVTLASRNNHDEDLFLHGVRHLYKATMLAPNHFQAPGFIGGEIHSHWMKTHL
PLGEPSLEDYLGSESVAIATKFLDHAIDRQSIYPTHFYHRGNIAFESGDLDAAISFFHLT
EVANGVIRDRKVDPELLVEASVIYNMLGVCYKKKGEVDTALDLLRKGIALYPEETDLHVN
AALILLYEGKPMEADAQLKAGLIAATQPGHIQKLRTIVNMLKESKMDTAVEVVLDRVAAL
ERQFSSN

Enzyme Prediction     

EC	2.4.1.109:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT105	82	247	3.2e-33	0.9312977099236641

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
400627	DUF1736	4.22e-20	300	357	17	74	Domain of unknown function (DUF1736). This domain of unknown function is found in various hypothetical metazoan proteins.
276809	TPR	7.30e-11	577	682	4	96	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	2.59e-06	623	682	3	62	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	6.10e-05	559	649	20	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
402494	YfdX	0.001	583	682	10	140	YfdX protein. YfdX is a protein found in Proteobacteria of unknown function. The protein coding for this gene is regulated by EvgA in E. coli.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAC25886.1|GT105	BAC25886.1|GT105	9.19e-66	31	469	41	506
BAC32288.1|GT105	BAC32288.1|GT105	1.06e-64	31	469	41	506
BAC28522.1|GT105	BAC28522.1|GT105	1.06e-64	31	469	41	506
BAC31900.1|GT105	BAC31900.1|GT105	1.06e-64	31	469	41	506
BAC33902.1|GT105	BAC33902.1|GT105	1.06e-64	31	469	41	506

PDB Hits     

PHYSODRAFT_471476-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8BG19|TMTC4_MOUSE	sp|Q8BG19|TMTC4_MOUSE	1.88e-65	31	469	41	506	Protein O-mannosyl-transferase TMTC4 OS=Mus musculus OX=10090 GN=Tmtc4 PE=2 SV=1
sp|Q5T4D3|TMTC4_HUMAN	sp|Q5T4D3|TMTC4_HUMAN	1.20e-63	31	456	42	492	Protein O-mannosyl-transferase TMTC4 OS=Homo sapiens OX=9606 GN=TMTC4 PE=1 SV=2
sp|Q6ZXV5|TMTC3_HUMAN	sp|Q6ZXV5|TMTC3_HUMAN	2.05e-58	24	520	21	527	Protein O-mannosyl-transferase TMTC3 OS=Homo sapiens OX=9606 GN=TMTC3 PE=1 SV=2
sp|Q8BRH0|TMTC3_MOUSE	sp|Q8BRH0|TMTC3_MOUSE	4.55e-57	4	520	8	532	Protein O-mannosyl-transferase TMTC3 OS=Mus musculus OX=10090 GN=Tmtc3 PE=1 SV=2
sp|Q7K4B6|TMTC3_DROME	sp|Q7K4B6|TMTC3_DROME	4.02e-56	30	492	55	561	Protein O-mannosyl-transferase Tmtc3 OS=Drosophila melanogaster OX=7227 GN=Tmtc3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000363	0.999600	CS pos: 28-29. Pr: 0.9650

TMHMM  Annotations     

Start	End
10	32
187	204
219	241
261	280
347	369
382	404