CAZyme Information: PHYSODRAFT_471041-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_471041-t26_1-p1
• CAZy Family: GH47
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
585		64434.98	7.4356

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:9757149-9758978(-)

Full Sequence      

MLQRSLQAKALAFRGRHGVQSALSSSAAPGEYDYVIVGGGSAGCVLANRLSADPNNKVLL
VESGPSDVGKWDSARIHMPAALAYNLADDRYNWNYYTEPQKNMDGRRIPWPRGRVLGGSS
SINAMVYNRGHTFDYDDWEKAGAKGWSYADCLPYFKKSTTHDLGEDEYRGGSGPMRITRK
TQDKAQPLFQAFIDAGVQAGYPEAVDMNGYQQEGLGWMDMTIHKGKRWSTAAGYLRPVMD
RKNLTVITDTLVNKVVFEGKKAVGIEVEDKSKAISQIRTAKEVILSSGAINTPQLLMLSG
VGDAEHLKEVGIPLVHHLPAIGKNMEDHLGTYLHFACKKPITLYNATWNFPHKMVAIALE
WLMSQTGPGSSSQIEAGGFIRTAPGKRHPDLQYHFIPGSIDEGLHVRAGHVMTAHCSTMR
ATSRGYLKLRSKNPREHPIIEPNYLDTQEDIVDLRNGVKLTREIVQQKAFDEFRGEALSP
TDDSQSDEAIDAWVRQNAGTVYHPSCTARMGVDENSAVDAETRVHGMEGLRIVDASIMPN
IVSGNLNGPVIMMAEKAADIILCNPALPKSNAPVYQAKNWETSQR

Enzyme Prediction     

No EC number prediction in PHYSODRAFT_471041-t26_1-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	31	562	9.3e-171	0.9929577464788732

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	0.0	25	567	1	539	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	0.0	31	585	5	555	choline dehydrogenase; Validated
274888	Rv0697	2.01e-98	33	562	2	487	dehydrogenase, Rv0697 family. This model describes a set of dehydrogenases belonging to the glucose-methanol-choline oxidoreductase (GMC oxidoreductase) family. Members of the present family are restricted to Actinobacterial genome contexts containing also members of families TIGR03962 and TIGR03969 (the mycofactocin system), and are proposed to be uniform in function.
366272	GMC_oxred_N	3.90e-58	104	329	15	217	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	2.75e-41	422	557	2	143	GMC oxidoreductase. This domain found associated with pfam00732.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28087.1|AA3_2	1.67e-303	1	585	1	581
CAB3230510.1|AA3_2	2.06e-224	20	584	13	578
ANI26486.1|AA3_2	1.78e-214	31	584	70	624
AWP09430.1|AA3_2	3.52e-214	31	576	19	565
CEF60566.1|AA3_2	4.46e-180	34	575	35	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7AV4_AAA	5.89e-95	5	561	57	636	Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
5NCC_A	9.93e-95	19	561	8	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]
6ZH7_A	2.54e-94	25	561	1	560	Chain A, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis],6ZH7_B Chain B, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YRU_AAA	3.57e-94	31	561	7	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRV_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRX_AAA Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis],6YRZ_AAA Chain AAA, Fatty acid photodecarboxylase, chloroplastic [Chlorella variabilis]
6YS1_AAA	5.02e-94	31	561	7	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6UPE0|CHDH_RAT	2.88e-222	22	584	34	599	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q8BJ64|CHDH_MOUSE	2.99e-221	31	584	42	596	Choline dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Chdh PE=1 SV=1
sp|Q8NE62|CHDH_HUMAN	1.49e-218	3	584	22	594	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q3K5H3|BETA_PSEPF	2.94e-186	31	577	4	549	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) OX=205922 GN=betA PE=3 SV=1
sp|Q4K4K7|BETA_PSEF5	8.36e-186	31	577	4	549	Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=betA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000047	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYSODRAFT_471041-t26_1-p1.