CAZyme Information: PHYSODRAFT_470234-t26_1-p1

Basic Information

• Species: Phytophthora sojae
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora sojae
• CAZyme ID: PHYSODRAFT_470234-t26_1-p1
• CAZy Family: GH43
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
901		100689.77	6.7404

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PsojaeP6497	28142	1094619	1653	26489

• Gene Location: location=JH159151:2379161-2381943(-)

Full Sequence      

MEQDGGGYVSSNAEEYDAAPSSGLPTPDGPDVWRDTRPTSHSYVDEPHANQPIERQLSYR
QPGLNPAAEETYEAAFRLIQLAADAERSGSPLQAIQLYTDAGDVLIKVGKREPDPLLKQG
IRQKANEIMKRAEELDEWYYSVQESARKAALPPQLQIQRTQVPRVQEAWQGRKPTLSQAP
EFTHMRYTAVSTKDPVKFSDDGFQLRVEEAGKKIRVFITITMYNEEGSELQGTLKGIARN
LEFMAEQWGDRAWESVAVAVVSDGRTKASASCLDFLAGLGAFDEEIMTVTSMGVDVQLHL
FEATVQLVRDDNFESFYPPIQLIYALKENNAGKLNSHLWFFNAFSEQLLPTYTVLVDVGT
IPGPTSIFKLIRSMDRNPQIGGVAGEIAVDHPNYFNPVIAAQHFEYKISNIMDKSLESVL
GFISVLPGAFSAYRYEAIRAEKGVGPLPEYFKSLTTSTRDLGPFKGNMYLAEDRILCFEL
LARRGRNWTMHYVKDAIARTDVPETLVDLIKQRRRWLNGSFFAGLFAISNFSRVWKESGH
SLSRKIVLTLQFIYLSVQNVLSWFLLSNLFLTFYYVLTLTLYSKYPALLAIVLGIYLAIV
GGIVVFALGNRPEKRTAAFYSFSYVFMGLVMLVVSVISIYGLVADVSVTDPRDDLASCSV
SNFELVGGVVTAIGLVFASAFIHGEFSVLLSTLQYYFMLPTFVNILGIYAYSNLHDLSWG
TKGLETAGHGAAKVAQGNGNLKEIVAQQKRIEAEKQRAAQEKEDVDNSFRAFRSSLLLFW
LVTNAVWMYCMTYFVSSSCYLKFISYVVAVFNVVRFFGSAVFLCFRIARRLGTCGASRSG
KSGRNYQAHLPAEWQAHYKRSSNATTETTTTGNGQQTYVGLNISDLSSPAATNYRNMEEV
R

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	222	374	8.3e-46	0.9938650306748467
GT2	353	600	1.3e-23	0.4478178368121442

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	1.10e-84	218	523	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
396286	Chitin_synth_1	1.05e-61	222	374	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
224136	BcsA	1.18e-30	302	644	96	409	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	4.57e-20	352	611	204	454	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133045	CESA_like	1.48e-15	322	443	55	171	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADE62521.1|GT2	0.0	32	864	77	937
ACA49151.2|GT2	5.57e-295	125	834	66	781
AAC49743.1|GT2|2.4.1.16	4.70e-292	32	777	74	789
ADE62520.1|GT2	1.76e-189	71	853	103	878
ACA96933.2|GT2	5.55e-174	75	840	33	805

PDB Hits     

PHYSODRAFT_470234-t26_1-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48017|CHS_SAPMO	8.34e-293	32	777	74	789	Chitin synthase OS=Saprolegnia monoica OX=37553 GN=CHS PE=3 SV=1
sp|P87073|CHS1_PHYB8	1.05e-126	181	827	134	838	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1
sp|P30595|CHS2_RHIOL	2.36e-125	181	827	151	855	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1
sp|P30594|CHS1_RHIOL	6.79e-124	181	827	149	855	Chitin synthase 1 OS=Rhizopus oligosporus OX=4847 GN=CHS1 PE=3 SV=1
sp|P30601|CHS2_EXODE	1.02e-121	181	827	220	917	Chitin synthase 2 OS=Exophiala dermatitidis OX=5970 GN=CHS2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

Start	End
516	535
555	577
587	609
622	644
659	681
688	710
776	798
803	825